Recombinant Human SOCS2 protein, GST-tagged

Cat.No. : SOCS2-3514H
Product Overview : Recombinant Human SOCS2 protein(O14508)(1-198aa), fused to N-terminal GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-198aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 49.2 kDa
AA Sequence : MTLRCLEPSGNGGEGTRSQWGTAGSAEEPSPQAARLAKALRELGQTGWYWGSMTVNEAKEKLKEAPEGTFLIRDSSHSDYLLTISVKTSAGPTNLRIEYQDGKFRLDSIICVKSKLKQFDSVVHLIDYYVQMCKDKRTGPEAPRNGTVHLYLTKPLYTSAPSLQHLCRLTINKCTGAIWGLPLPTRLKDYLEEYKFQV
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name SOCS2 suppressor of cytokine signaling 2 [ Homo sapiens ]
Official Symbol SOCS2
Synonyms SOCS2; suppressor of cytokine signaling 2; CIS2; Cish2; SOCS 2; SSI 2; SSI2; STAT induced STAT inhibitor 2; STATI2; CIS-2; STAT induced STAT inhibitor-2; STAT-induced STAT inhibitor 2; STAT-induced STAT inhibitor-2; cytokine-inducible SH2 protein 2; suppressor of cytokine signaling-2; SSI-2; SOCS-2;
Gene ID 8835
mRNA Refseq NM_003877
Protein Refseq NP_003868
MIM 605117
UniProt ID O14508

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SOCS2 Products

Required fields are marked with *

My Review for All SOCS2 Products

Required fields are marked with *

0
cart-icon
0
compare icon