Recombinant Human SOCS3 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | SOCS3-1315H |
Product Overview : | SOCS3 MS Standard C13 and N15-labeled recombinant protein (NP_003946) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a member of the STAT-induced STAT inhibitor (SSI), also known as suppressor of cytokine signaling (SOCS), family. SSI family members are cytokine-inducible negative regulators of cytokine signaling. The expression of this gene is induced by various cytokines, including IL6, IL10, and interferon (IFN)-gamma. The protein encoded by this gene can bind to JAK2 kinase, and inhibit the activity of JAK2 kinase. Studies of the mouse counterpart of this gene suggested the roles of this gene in the negative regulation of fetal liver hematopoiesis, and placental development. |
Molecular Mass : | 24.8 kDa |
AA Sequence : | MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLLSAEPAGTFLIRDSSDQRHFFTLSVKTQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCVLKLVHHYMPPPGAPSFPSPPTEPSSEVPEQPSAQPLPGSPPRRAYYIYSGGEKIPLVLSRPLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | SOCS3 suppressor of cytokine signaling 3 [ Homo sapiens (human) ] |
Official Symbol | SOCS3 |
Synonyms | SOCS3; suppressor of cytokine signaling 3; CIS3; Cish3; SOCS 3; SSI 3; CIS-3; STAT-induced STAT inhibitor 3; cytokine-induced SH2 protein 3; cytokine-inducible SH2 protein 3; SSI3; ATOD4; SSI-3; SOCS-3; MGC71791; |
Gene ID | 9021 |
mRNA Refseq | NM_003955 |
Protein Refseq | NP_003946 |
MIM | 604176 |
UniProt ID | O14543 |
◆ Recombinant Proteins | ||
SOCS3-2068H | Recombinant Human SOCS3 Protein, His (Fc)-Avi-tagged | +Inquiry |
SOCS3-1526R | Recombinant Rat SOCS3 Protein (1-225 aa), His-tagged | +Inquiry |
SOCS3-1793HFL | Recombinant Full Length Human SOCS3 Protein, C-Flag-tagged | +Inquiry |
SOCS3-5324R | Recombinant Rat SOCS3 Protein, His (Fc)-Avi-tagged | +Inquiry |
SOCS3-6168C | Recombinant Chicken SOCS3 | +Inquiry |
◆ Cell & Tissue Lysates | ||
SOCS3-1580HCL | Recombinant Human SOCS3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SOCS3 Products
Required fields are marked with *
My Review for All SOCS3 Products
Required fields are marked with *