Recombinant Human SOCS6 protein, His-tagged
| Cat.No. : | SOCS6-2666H |
| Product Overview : | Recombinant Human SOCS6 protein(132-385 aa), fused to His tag, was expressed in E. coli. |
| Availability | November 21, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 132-385 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | YSPAPWPLRPTNSEETCIKMEVRVKALVHSSSPSPALNGVRKDFHDLQSETTCQEQANSLKSSASHNGDLHLHLDEHVPVVIGLMPQDYIQYTVPLDEGMYPLEGSRSYCLDSSSPMEVSAVPPQVGGRAFPEDESQVDQDLVVAPEIFVDQSVNGLLIGTTGVMLQSPRAGHDDVPPLSPLLPPMQNNQIQRNFSGLTGTEAHVAESMRCHLNFDPNSAPGVARVYDSVQSSGPMVVTSLTEELKKLAKQGWY |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | SOCS6 suppressor of cytokine signaling 6 [ Homo sapiens ] |
| Official Symbol | SOCS6 |
| Synonyms | SOCS6; suppressor of cytokine signaling 6; SOCS4, suppressor of cytokine signaling 4; CIS4; Cish4; HSPC060; SSI4; STAI4; STATI4; STAT induced STAT inhibitor-4; cytokine-inducible SH2 protein 4; suppressor of cytokine signaling 4; CIS-4; SOCS4; SOCS-4; SOCS-6; |
| Gene ID | 9306 |
| mRNA Refseq | NM_004232 |
| Protein Refseq | NP_004223 |
| MIM | 605118 |
| UniProt ID | O14544 |
| ◆ Recombinant Proteins | ||
| SOCS6-15747M | Recombinant Mouse SOCS6 Protein | +Inquiry |
| SOCS6-2666H | Recombinant Human SOCS6 protein, His-tagged | +Inquiry |
| SOCS6-540H | Recombinant Human SOCS6 Protein, His-tagged | +Inquiry |
| SOCS6-2873H | Recombinant Human SOCS6, GST-tagged | +Inquiry |
| SOCS6-3839C | Recombinant Chicken SOCS6 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SOCS6-1577HCL | Recombinant Human SOCS6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SOCS6 Products
Required fields are marked with *
My Review for All SOCS6 Products
Required fields are marked with *
