Recombinant Human SOCS6 protein, His-tagged
Cat.No. : | SOCS6-2666H |
Product Overview : | Recombinant Human SOCS6 protein(132-385 aa), fused to His tag, was expressed in E. coli. |
Availability | September 08, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 132-385 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | YSPAPWPLRPTNSEETCIKMEVRVKALVHSSSPSPALNGVRKDFHDLQSETTCQEQANSLKSSASHNGDLHLHLDEHVPVVIGLMPQDYIQYTVPLDEGMYPLEGSRSYCLDSSSPMEVSAVPPQVGGRAFPEDESQVDQDLVVAPEIFVDQSVNGLLIGTTGVMLQSPRAGHDDVPPLSPLLPPMQNNQIQRNFSGLTGTEAHVAESMRCHLNFDPNSAPGVARVYDSVQSSGPMVVTSLTEELKKLAKQGWY |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | SOCS6 suppressor of cytokine signaling 6 [ Homo sapiens ] |
Official Symbol | SOCS6 |
Synonyms | SOCS6; suppressor of cytokine signaling 6; SOCS4, suppressor of cytokine signaling 4; CIS4; Cish4; HSPC060; SSI4; STAI4; STATI4; STAT induced STAT inhibitor-4; cytokine-inducible SH2 protein 4; suppressor of cytokine signaling 4; CIS-4; SOCS4; SOCS-4; SOCS-6; |
Gene ID | 9306 |
mRNA Refseq | NM_004232 |
Protein Refseq | NP_004223 |
MIM | 605118 |
UniProt ID | O14544 |
◆ Recombinant Proteins | ||
SOCS6-2666H | Recombinant Human SOCS6 protein, His-tagged | +Inquiry |
SOCS6-15747M | Recombinant Mouse SOCS6 Protein | +Inquiry |
SOCS6-3839C | Recombinant Chicken SOCS6 | +Inquiry |
SOCS6-2873H | Recombinant Human SOCS6, GST-tagged | +Inquiry |
SOCS6-540H | Recombinant Human SOCS6 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SOCS6-1577HCL | Recombinant Human SOCS6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SOCS6 Products
Required fields are marked with *
My Review for All SOCS6 Products
Required fields are marked with *