Recombinant Human SOD1 Protein, MYC/DDK-tagged, C13 and N15-labeled

Cat.No. : SOD1-070H
Product Overview : SOD1 MS Standard C13 and N15-labeled recombinant protein (NP_000445) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The protein encoded by this gene binds copper and zinc ions and is one of two isozymes responsible for destroying free superoxide radicals in the body. The encoded isozyme is a soluble cytoplasmic protein, acting as a homodimer to convert naturally-occuring but harmful superoxide radicals to molecular oxygen and hydrogen peroxide. The other isozyme is a mitochondrial protein. Mutations in this gene have been implicated as causes of familial amyotrophic lateral sclerosis. Rare transcript variants have been reported for this gene.
Molecular Mass : 15.9 kDa
AA Sequence : MATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHCIIGRTLVVHEKADDLGKGGNEESTKTGNAGSRLACGVIGIAQTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name SOD1 superoxide dismutase 1 [ Homo sapiens (human) ]
Official Symbol SOD1
Synonyms SOD1; superoxide dismutase 1; ALS; ALS1; HEL-S-44; homodimer; hSod1; IPOA; SOD; superoxide dismutase [Cu-Zn]; Cu/Zn superoxide dismutase; SOD, soluble; epididymis secretory protein Li 44; indophenoloxidase A; superoxide dismutase 1, soluble; superoxide dismutase, cystolic; EC 1.15.1.1
Gene ID 6647
mRNA Refseq NM_000454
Protein Refseq NP_000445
MIM 147450
UniProt ID P00441

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SOD1 Products

Required fields are marked with *

My Review for All SOD1 Products

Required fields are marked with *

0
cart-icon