Recombinant Human SOD1 Protein, MYC/DDK-tagged, C13 and N15-labeled

• Cat.No.: SOD1-070H
• Product Overview: SOD1 MS Standard C13 and N15-labeled recombinant protein (NP_000445) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: The protein encoded by this gene binds copper and zinc ions and is one of two isozymes responsible for destroying free superoxide radicals in the body. The encoded isozyme is a soluble cytoplasmic protein, acting as a homodimer to convert naturally-occuring but harmful superoxide radicals to molecular oxygen and hydrogen peroxide. The other isozyme is a mitochondrial protein. Mutations in this gene have been implicated as causes of familial amyotrophic lateral sclerosis. Rare transcript variants have been reported for this gene.
• Molecular Mass: 15.9 kDa
• AA Sequence: MATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHCIIGRTLVVHEKADDLGKGGNEESTKTGNAGSRLACGVIGIAQTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: SOD1 superoxide dismutase 1 [ Homo sapiens (human) ]
• Official Symbol: SOD1
• Synonyms: SOD1; superoxide dismutase 1; ALS; ALS1; HEL-S-44; homodimer; hSod1; IPOA; SOD; superoxide dismutase [Cu-Zn]; Cu/Zn superoxide dismutase; SOD, soluble; epididymis secretory protein Li 44; indophenoloxidase A; superoxide dismutase 1, soluble; superoxide dismutase, cystolic; EC 1.15.1.1
• Gene ID: 6647
• mRNA Refseq: NM_000454
• Protein Refseq: NP_000445
• MIM: 147450
• UniProt ID: P00441