Recombinant Human SOD2 protein(25-222 aa), N-GST-tagged
Cat.No. : | SOD2-2541H |
Product Overview : | Recombinant Human SOD2 protein(P04179)(25-222 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 25-222 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | KHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK |
Gene Name | SOD2 superoxide dismutase 2, mitochondrial [ Homo sapiens ] |
Official Symbol | SOD2 |
Synonyms | SOD2; superoxide dismutase 2, mitochondrial; superoxide dismutase [Mn], mitochondrial; indophenoloxidase B; Mn superoxide dismutase; mangano-superoxide dismutase; manganese-containing superoxide dismutase; IPOB; MNSOD; MVCD6; |
Gene ID | 6648 |
mRNA Refseq | NM_000636 |
Protein Refseq | NP_000627 |
MIM | 147460 |
UniProt ID | P04179 |
◆ Recombinant Proteins | ||
SOD2-31474TH | Recombinant Human SOD2 | +Inquiry |
SOD2-738H | Recombinant Human SOD2, MYC-DDK-tagged | +Inquiry |
Sod2-56M | Recombinant Mouse Sod2, His-tagged | +Inquiry |
SOD2-31475TH | Recombinant Human SOD2 | +Inquiry |
PDE2A-145H | Recombinant Human SOD2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SOD2-1574HCL | Recombinant Human SOD2 293 Cell Lysate | +Inquiry |
SOD2-1575HCL | Recombinant Human SOD2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SOD2 Products
Required fields are marked with *
My Review for All SOD2 Products
Required fields are marked with *