Recombinant Human SOD2 Protein, N-His-tagged
Cat.No. : | SOD2-062H |
Product Overview : | Recombinant human SOD2 protein with N-His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 222 |
Description : | This gene is a member of the iron/manganese superoxide dismutase family. It encodes a mitochondrial protein that forms a homotetramer and binds one manganese ion per subunit. This protein binds to the superoxide byproducts of oxidative phosphorylation and converts them to hydrogen peroxide and diatomic oxygen. Mutations in this gene have been associated with idiopathic cardiomyopathy (IDC), premature aging, sporadic motor neuron disease, and cancer. Alternative splicing of this gene results in multiple transcript variants. A related pseudogene has been identified on chromosome 1. |
Form : | Solution |
Molecular Mass : | 24.4 kDa |
AA Sequence : | MLSRAVCGTSRQLAPVLGYLGSRQKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK |
Purity : | > 95% |
Applications : | WB; ELISA; FACS; FC |
Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : | 4°C |
Concentration : | 1 mg/mL |
Storage Buffer : | Tris-HCl (pH 8). Sterile-filtered colorless solution. |
Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
Gene Name | SOD2 superoxide dismutase 2, mitochondrial [ Homo sapiens (human) ] |
Official Symbol | SOD2 |
Synonyms | SOD2; superoxide dismutase 2, mitochondrial; superoxide dismutase [Mn], mitochondrial; indophenoloxidase B; Mn superoxide dismutase; mangano-superoxide dismutase; manganese-containing superoxide dismutase; IPOB; MNSOD; MVCD6; |
Gene ID | 6648 |
mRNA Refseq | NM_000636 |
Protein Refseq | NP_000627 |
MIM | 147460 |
UniProt ID | P04179 |
◆ Recombinant Proteins | ||
SOD2-2681H | Recombinant Human SOD2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SOD2-1181H | Active Recombinant Human Manganese Superoxide Dismutage/ SOD2 / MnSOD protein, Tag Free | +Inquiry |
PDE2A-145H | Recombinant Human SOD2 Protein | +Inquiry |
SOD2-2513H | Recombinant Human SOD2 protein, His-tagged | +Inquiry |
SOD2-4222R | Recombinant Rhesus Macaque SOD2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SOD2-1575HCL | Recombinant Human SOD2 293 Cell Lysate | +Inquiry |
SOD2-1574HCL | Recombinant Human SOD2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SOD2 Products
Required fields are marked with *
My Review for All SOD2 Products
Required fields are marked with *
0
Inquiry Basket