Recombinant Human SOHLH2 protein, GST-tagged
| Cat.No. : | SOHLH2-2177H |
| Product Overview : | Recombinant Human SOHLH2 protein(1-225 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E. coli |
| Tag : | GST |
| Protein Length : | 1-225 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
| AASequence : | MASSIICQEHCQISGQAKIDILLVGDVTVGYLADTVQKLFANIAEVTITISDTKEAAALLDDCIFNMVLLKVPSSLSAEELEAIKLIRFGKKKNTHSLFVFIIPENFKGCISGHGMDIALTEPLTMEKMSNVVKYWTTCPSNTVKTENATGPEELGLPLQRSYSEHLGYFPTDLFACSESLRNGNGLELNASLSEFEKNKKISLLHSSKEKLRRLYRKHSSFCFW |
| Purity : | 85%, by SDS-PAGE. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| Gene Name | SOHLH2 spermatogenesis and oogenesis specific basic helix-loop-helix 2 [ Homo sapiens ] |
| Official Symbol | SOHLH2 |
| Synonyms | SOHLH2; spermatogenesis and oogenesis specific basic helix-loop-helix 2; spermatogenesis- and oogenesis-specific basic helix-loop-helix-containing protein 2; bHLHe81; FLJ20449; TEB1; FLJ57222; |
| mRNA Refseq | NM_017826 |
| Protein Refseq | NP_060296 |
| UniProt ID | Q9NX45 |
| Gene ID | 54937 |
| ◆ Recombinant Proteins | ||
| SOHLH2-8572M | Recombinant Mouse SOHLH2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| SOHLH2-5328R | Recombinant Rat SOHLH2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| SOHLH2-4259H | Recombinant Human SOHLH2 Protein, GST-tagged | +Inquiry |
| SOHLH2-2876H | Recombinant Human SOHLH2 protein, His-tagged | +Inquiry |
| SOHLH2-5669R | Recombinant Rat SOHLH2 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SOHLH2-1667HCL | Recombinant Human SOHLH2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SOHLH2 Products
Required fields are marked with *
My Review for All SOHLH2 Products
Required fields are marked with *
