Recombinant Human SOHLH2 Protein, GST-tagged
| Cat.No. : | SOHLH2-4259H |
| Product Overview : | Human FLJ20449 full-length ORF ( AAH25383, 1 a.a. - 225 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes one of testis-specific transcription factors which are essential for spermatogenesis, oogenesis and folliculogenesis. This gene is located on chromosome 13. The proteins encoded by this gene and another testis-specific transcription factor, SOHLH1, can form heterodimers, in addition to homodimers. There is a read-through locus (GeneID: 100526761) that shares sequence identity with this gene and the upstream CCDC169 (GeneID: 728591). Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2013] |
| Molecular Mass : | 50.49 kDa |
| AA Sequence : | MASSIICQEHCQISGQAKIDILLVGDVTVGYLADTVQKLFANIAEVTITISDTKEAAALLDDCIFNMVLLKVPSSLSAEELEAIKLIRFGKKKNTHSLFVFIIPENFKGCISGHGMDIALTEPLTMEKMSNVVKYWTTCPSNTVKTENATGPEELGLPLQRSYSEHLGYFPTDLFACSESLRNGNGLELNASLSEFEKNKKISLLHSSKEKLRRLYRKHSSFCFW |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | SOHLH2 spermatogenesis and oogenesis specific basic helix-loop-helix 2 [ Homo sapiens ] |
| Official Symbol | SOHLH2 |
| Synonyms | SOHLH2; spermatogenesis and oogenesis specific basic helix-loop-helix 2; spermatogenesis- and oogenesis-specific basic helix-loop-helix-containing protein 2; bHLHe81; FLJ20449; TEB1; FLJ57222; |
| Gene ID | 54937 |
| mRNA Refseq | NM_017826 |
| Protein Refseq | NP_060296 |
| MIM | 616066 |
| UniProt ID | Q9NX45 |
| ◆ Recombinant Proteins | ||
| SOHLH2-2876H | Recombinant Human SOHLH2 protein, His-tagged | +Inquiry |
| SOHLH2-2177H | Recombinant Human SOHLH2 protein, GST-tagged | +Inquiry |
| SOHLH2-8572M | Recombinant Mouse SOHLH2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| SOHLH2-4888HF | Recombinant Full Length Human SOHLH2 Protein, GST-tagged | +Inquiry |
| SOHLH2-4259H | Recombinant Human SOHLH2 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SOHLH2-1667HCL | Recombinant Human SOHLH2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SOHLH2 Products
Required fields are marked with *
My Review for All SOHLH2 Products
Required fields are marked with *
