Recombinant Human SOX13 protein, GST-tagged
| Cat.No. : | SOX13-2881H |
| Product Overview : | Recombinant Human SOX13 protein(1-301 aa), fused with N-terminal GST tag, was expressed in E.coli. |
| Availability | January 08, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-301 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
| AASequence : | MSMRSPISAQLALDGVGTMVNCTIKSEEKKEPCHEAPQGSATAAEPQPGDPARASQDSADPQAPAQGNFRGSWDCSSPEGNGSPEPKRPGVSEAASGSQEKLDFNRNLKEVVPAIEKLLSSDWKERFLGRNSMEAKDVKGTQESLAEKELQLLVMIHQLSTLRDQLLTAHSEQKNMAAMLFEKQQQQMELARQQQEQIAKQQQQLIQQQHKINLLQQQIQQVNMPYVMIPAFPPSHQPLPVTPDSQLALPIQPIPCKPVEYPLQLLHSPPAPVVKRPGAMATHHPLQEPSQPLNLTAKPKA |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | SOX13 SRY (sex determining region Y)-box 13 [ Homo sapiens ] |
| Official Symbol | SOX13 |
| Synonyms | SOX13; SRY (sex determining region Y)-box 13; transcription factor SOX-13; ICA12; islet cell 12; MGC117216; Sox 13; SRY box 13; SRY related HMG box gene 13; type 1 diabetes autoantigen; SRY-box 13; islet cell antigen 12; SRY-related HMG-box gene 13; type 1 diabetes autoantigen ICA12; Sox-13; |
| Gene ID | 9580 |
| mRNA Refseq | NM_005686 |
| Protein Refseq | NP_005677 |
| MIM | 604748 |
| UniProt ID | Q9UN79 |
| ◆ Recombinant Proteins | ||
| SOX13-1811HFL | Recombinant Full Length Human SOX13 Protein, C-Flag-tagged | +Inquiry |
| Sox13-6050M | Recombinant Mouse Sox13 Protein, Myc/DDK-tagged | +Inquiry |
| SOX13-5063H | Recombinant Human SOX13 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| SOX13-15775M | Recombinant Mouse SOX13 Protein | +Inquiry |
| SOX13-8586M | Recombinant Mouse SOX13 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SOX13-1563HCL | Recombinant Human SOX13 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SOX13 Products
Required fields are marked with *
My Review for All SOX13 Products
Required fields are marked with *
