Recombinant Human SOX15 protein, 61-140AA, C-His-tagged
| Cat.No. : | SOX15-96H |
| Product Overview : | Recombinant Human SOX15 protein(O60248)(61-140aa), fused with C-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Form : | 0.15 M Phosphate buffered saline |
| AA Sequence : | SAQRRQMAQQNPKMHNSEISKRLGAQWKLLDEDEKRPFVEEAKRLRARHLRDYPDYKYRPRRKAKSSGAGPSRCGQGRGN |
| Storage : | 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80 °C |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| Gene Name | SOX15 SRY (sex determining region Y)-box 15 [ Homo sapiens ] |
| Official Symbol | SOX15 |
| Synonyms | SOX15; SRY (sex determining region Y)-box 15; SOX20, SRY (sex determining region Y) box 20; protein SOX-15; SOX26; SOX27; SRY (sex determining region Y)-box 20; SOX20 |
| Gene ID | 6665 |
| mRNA Refseq | NM_006942 |
| Protein Refseq | NP_008873 |
| MIM | 601297 |
| UniProt ID | O60248 |
| ◆ Recombinant Proteins | ||
| SOX15-96H | Recombinant Human SOX15 protein, 61-140AA, C-His-tagged | +Inquiry |
| SOX15-8588M | Recombinant Mouse SOX15 Protein, His (Fc)-Avi-tagged | +Inquiry |
| SOX15-15777M | Recombinant Mouse SOX15 Protein | +Inquiry |
| SOX15-182H | Recombinant Human SOX15 protein, T7/His-tagged | +Inquiry |
| SOX15-95H | Recombinant Human SOX15 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SOX15 Products
Required fields are marked with *
My Review for All SOX15 Products
Required fields are marked with *
