Recombinant Human SOX15 protein, 61-140AA, C-His-tagged

Cat.No. : SOX15-96H
Product Overview : Recombinant Human SOX15 protein(O60248)(61-140aa), fused with C-terminal His tag, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Form : 0.15 M Phosphate buffered saline
AA Sequence : SAQRRQMAQQNPKMHNSEISKRLGAQWKLLDEDEKRPFVEEAKRLRARHLRDYPDYKYRPRRKAKSSGAGPSRCGQGRGN
Storage : 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80 °C
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
Gene Name SOX15 SRY (sex determining region Y)-box 15 [ Homo sapiens ]
Official Symbol SOX15
Synonyms SOX15; SRY (sex determining region Y)-box 15; SOX20, SRY (sex determining region Y) box 20; protein SOX-15; SOX26; SOX27; SRY (sex determining region Y)-box 20; SOX20
Gene ID 6665
mRNA Refseq NM_006942
Protein Refseq NP_008873
MIM 601297
UniProt ID O60248

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SOX15 Products

Required fields are marked with *

My Review for All SOX15 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon