Recombinant Human SOX15 protein, T7/His-tagged

Cat.No. : SOX15-182H
Product Overview : Recombinant human Sox15 cDNA ( 232 aa, derived from BC000985 ) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&T7
Form : 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence : MASMTGGQQMGRGHHHHHHENLYFQGGEFALPGSSQDQAWSLEPPAATAAASSSSGPQEREGAGSPAAPGTLPLE KVKRPMNAFMVWSSAQRRQMAQQNPKMHNSEISKRLGAQWKLLDEDEKRPFVEEAKRLRARHLRDYPDYKYRPRR KAKSSGAGPSRCGQGRGNLASGGPLWGPGYATTQPSRGFGYRPPSYSTAYLPGSYGSSHCKLEAPSPCSLPQSDP RLQGELLPTYTHYLPPGSPTPYNPPLAGAPMPLTHL
Purity : >90% by SDS-PAGE
Storage : Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
Gene Name SOX15 SRY (sex determining region Y)-box 15 [ Homo sapiens ]
Official Symbol SOX15
Synonyms SOX15; SRY (sex determining region Y)-box 15; SOX20, SRY (sex determining region Y) box 20; protein SOX-15; SOX26; SOX27; SRY (sex determining region Y)-box 20; SOX20;
Gene ID 6665
mRNA Refseq NM_006942
Protein Refseq NP_008873
MIM 601297
UniProt ID O60248
Chromosome Location 17p12.3
Function DNA binding; chromatin binding; sequence-specific DNA binding transcription factor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SOX15 Products

Required fields are marked with *

My Review for All SOX15 Products

Required fields are marked with *

0
cart-icon