"SOX15" Related Products

Recombinant Human SOX15 protein, T7/His-tagged

Cat.No. : SOX15-182H
Product Overview : Recombinant human Sox15 cDNA ( 232 aa, derived from BC000985 ) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.
Source : E. coli
Species : Human
Tag : T7/His
Form : 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence : MASMTGGQQMGRGHHHHHHENLYFQGGEFALPGSSQDQAWSLEPPAATAAASSSSGPQEREGAGSPAAPGTLPLE KVKRPMNAFMVWSSAQRRQMAQQNPKMHNSEISKRLGAQWKLLDEDEKRPFVEEAKRLRARHLRDYPDYKYRPRR KAKSSGAGPSRCGQGRGNLASGGPLWGPGYATTQPSRGFGYRPPSYSTAYLPGSYGSSHCKLEAPSPCSLPQSDP RLQGELLPTYTHYLPPGSPTPYNPPLAGAPMPLTHL
Purity : >90% by SDS-PAGE
Storage : Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
Gene Name : SOX15 SRY (sex determining region Y)-box 15 [ Homo sapiens ]
Official Symbol : SOX15
Synonyms : SOX15; SRY (sex determining region Y)-box 15; SOX20, SRY (sex determining region Y) box 20; protein SOX-15; SOX26; SOX27; SRY (sex determining region Y)-box 20; SOX20;
Gene ID : 6665
mRNA Refseq : NM_006942
Protein Refseq : NP_008873
MIM : 601297
UniProt ID : O60248
Chromosome Location : 17p12.3
Function : DNA binding; chromatin binding; sequence-specific DNA binding transcription factor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.