Recombinant Human SPACA4 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | SPACA4-2108H |
Product Overview : | SPACA4 MS Standard C13 and N15-labeled recombinant protein (NP_598005) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Sperm surface membrane protein that may be involved in sperm-egg plasma membrane adhesion and fusion during fertilization. |
Molecular Mass : | 13 kDa |
AA Sequence : | MVLCWLLLLVMALPPGTTGVKDCVFCELTDSMQCPGTYMHCGDDEDCFTGHGVAPGTGPVINKGCLRATSCGLEEPVSYRGVTYSLTTNCCTGRLCNRAPSSQTVGATTSLALGLGMLLPPRLLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | SPACA4 sperm acrosome associated 4 [ Homo sapiens (human) ] |
Official Symbol | SPACA4 |
Synonyms | SPACA4; sperm acrosome associated; SAMP14; sperm acrosome membrane-associated protein 4; sperm acrosomal membrane protein 14; sperm acrosomal membrane-associated protein 14; testicular tissue protein Li 167 |
Gene ID | 171169 |
mRNA Refseq | NM_133498 |
Protein Refseq | NP_598005 |
MIM | 609932 |
UniProt ID | Q8TDM5 |
◆ Recombinant Proteins | ||
SPACA4-2108H | Recombinant Human SPACA4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SPACA4-8601M | Recombinant Mouse SPACA4 Protein, His (Fc)-Avi-tagged | +Inquiry |
SPACA4-15804M | Recombinant Mouse SPACA4 Protein | +Inquiry |
Spaca4-6066M | Recombinant Mouse Spaca4 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SPACA4-1551HCL | Recombinant Human SPACA4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SPACA4 Products
Required fields are marked with *
My Review for All SPACA4 Products
Required fields are marked with *
0
Inquiry Basket