Recombinant Human SPANXN3 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | SPANXN3-4292H |
Product Overview : | SPANXN3 MS Standard C13 and N15-labeled recombinant protein (NP_001009609) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Belongs to the SPAN-X family. |
Molecular Mass : | 15.6 kDa |
AA Sequence : | MEQPTSSTNGEKTKSPCESNNKKNDEMQEVPNRVLAPEQSLKKTKTSEYPIIFVYYLRKGKKINSNQLENEQSQENSINPIQKEEDEGVDLSEGSSNEDEDLGPCEGPSKEDKDLDSSEGSSQEDEDLGLSEGSSQDSGEDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | SPANXN3 SPANX family member N3 [ Homo sapiens (human) ] |
Official Symbol | SPANXN3 |
Synonyms | SPANXN3; SPANX family member N3; CT11.8; SPANX-N3; sperm protein associated with the nucleus on the X chromosome N3; cancer/testis antigen family 11, member 8; nuclear-associated protein SPAN-Xn3 |
Gene ID | 139067 |
mRNA Refseq | NM_001009609 |
Protein Refseq | NP_001009609 |
MIM | 300666 |
UniProt ID | Q5MJ09 |
◆ Recombinant Proteins | ||
SPANXN3-2898H | Recombinant Human SPANXN3, GST-tagged | +Inquiry |
SPANXN3-4292H | Recombinant Human SPANXN3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SPANXN3-2504H | Recombinant Human SPANXN3 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SPANXN3-1543HCL | Recombinant Human SPANXN3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SPANXN3 Products
Required fields are marked with *
My Review for All SPANXN3 Products
Required fields are marked with *
0
Inquiry Basket