Recombinant Human SPANXN3 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : SPANXN3-4292H
Product Overview : SPANXN3 MS Standard C13 and N15-labeled recombinant protein (NP_001009609) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Belongs to the SPAN-X family.
Molecular Mass : 15.6 kDa
AA Sequence : MEQPTSSTNGEKTKSPCESNNKKNDEMQEVPNRVLAPEQSLKKTKTSEYPIIFVYYLRKGKKINSNQLENEQSQENSINPIQKEEDEGVDLSEGSSNEDEDLGPCEGPSKEDKDLDSSEGSSQEDEDLGLSEGSSQDSGEDTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name SPANXN3 SPANX family member N3 [ Homo sapiens (human) ]
Official Symbol SPANXN3
Synonyms SPANXN3; SPANX family member N3; CT11.8; SPANX-N3; sperm protein associated with the nucleus on the X chromosome N3; cancer/testis antigen family 11, member 8; nuclear-associated protein SPAN-Xn3
Gene ID 139067
mRNA Refseq NM_001009609
Protein Refseq NP_001009609
MIM 300666
UniProt ID Q5MJ09

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SPANXN3 Products

Required fields are marked with *

My Review for All SPANXN3 Products

Required fields are marked with *

0
cart-icon
0
compare icon