Recombinant Human SPARC Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : SPARC-6051H
Product Overview : SPARC MS Standard C13 and N15-labeled recombinant protein (NP_003109) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a cysteine-rich acidic matrix-associated protein. The encoded protein is required for the collagen in bone to become calcified but is also involved in extracellular matrix synthesis and promotion of changes to cell shape. The gene product has been associated with tumor suppression but has also been correlated with metastasis based on changes to cell shape which can promote tumor cell invasion. Three transcript variants encoding different isoforms have been found for this gene.
Molecular Mass : 34.6 kDa
AA Sequence : MRAWIFFLLCLAGRALAAPQQEALPDETEVVEETVAEVTEVSVGANPVQVEVGEFDDGAEETEEEVVAENPCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIPPCLDSELTEFPLRMRDWLKNVLVTLYERDEDNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKQKDIDKDLVITRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name SPARC secreted protein acidic and cysteine rich [ Homo sapiens (human) ]
Official Symbol SPARC
Synonyms SPARC; secreted protein, acidic, cysteine-rich (osteonectin); ON; cysteine rich protein; osteonectin; BM-40; cysteine-rich protein; basement-membrane protein 40; secreted protein acidic and rich in cysteine;
Gene ID 6678
mRNA Refseq NM_003118
Protein Refseq NP_003109
MIM 182120
UniProt ID P09486

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SPARC Products

Required fields are marked with *

My Review for All SPARC Products

Required fields are marked with *

0
cart-icon
0
compare icon