Recombinant Human SPATA2 protein, His-tagged
Cat.No. : | SPATA2-2789H |
Product Overview : | Recombinant Human SPATA2 protein(171-520 aa), fused to His tag, was expressed in E. coli. |
Availability | August 29, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 171-520 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | VECEQMLEIHSQVKDKGYSELDIVSERKSSAEDVRGCSDALRRRAEGREHLTASMSRVALQKSASERAAKDYYKPRVTKPSRSVDAYDSYWESRKPPLKASLSLRKEPVATDVGDDLKDEIIRPSPSLLTMASSPHGSPDVLPPASPSNGPALLRGTYFSTQDDVDLYTDSEPRATYRRQDALRPDVWLLRNDAHSLYHKRSPPAKESALSKCQSCGLSCSSSLCQRCDSLLTCPPASKPSAFPSKASTHDSLAHGASLREKYPGQTQGLDRLPHLHSKSKPSTTPTSRCGFCNRPGATNTCTQCSKVSCDACLSAYHYDPCYKKSELHKFMPNNQLNYKSTQLSHLVYR |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | SPATA2 spermatogenesis associated 2 [ Homo sapiens ] |
Official Symbol | SPATA2 |
Synonyms | SPATA2; spermatogenesis associated 2; spermatogenesis-associated protein 2; KIAA0757; PD1; tamo; spermatogenesis associated PD1; spermatogenesis-associated protein PD1; FLJ13167; |
Gene ID | 9825 |
mRNA Refseq | NM_001135773 |
Protein Refseq | NP_001129245 |
MIM | 607662 |
UniProt ID | Q9UM82 |
◆ Recombinant Proteins | ||
SPATA2-4239R | Recombinant Rhesus Macaque SPATA2 Protein, His (Fc)-Avi-tagged | +Inquiry |
SPATA2-1784C | Recombinant Chicken SPATA2 | +Inquiry |
SPATA2-4423R | Recombinant Rhesus monkey SPATA2 Protein, His-tagged | +Inquiry |
SPATA2-2789H | Recombinant Human SPATA2 protein, His-tagged | +Inquiry |
SPATA2-5047Z | Recombinant Zebrafish SPATA2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
SPATA2-1538HCL | Recombinant Human SPATA2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SPATA2 Products
Required fields are marked with *
My Review for All SPATA2 Products
Required fields are marked with *