Recombinant Human SPATA25 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | SPATA25-3768H |
Product Overview : | C20orf165 MS Standard C13 and N15-labeled recombinant protein (NP_542175) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | SPATA25 (Spermatogenesis Associated 25) is a Protein Coding gene. |
Molecular Mass : | 23.8 kDa |
AA Sequence : | MSYFRTPQTHPGPLPSGQGGAASPGLSLGLCSPVEPVVVASGGTGPLSQKAEQVAPAAQAWGPALAMPQARGCPGGTSWETLRKEYSRNCHKFPHVRQLESLGWDNGYSRSRAPDLGGPSRPRPLMLCGLSPRVLPVPSEAVGKEASSQPDICILTLAMMIAGIPTVPVPGVREEDLIWAAQAFMMAHPEPEGAVEGARWEQAHAHTASGKMPLVRSKRGQPPGSCLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | SPATA25 spermatogenesis associated 25 [ Homo sapiens (human) ] |
Official Symbol | SPATA25 |
Synonyms | SPATA25; spermatogenesis associated 25; TSG23; C20orf165; dJ337O18.8; spermatogenesis-associated protein 25; testis-specific gene 23 protein |
Gene ID | 128497 |
mRNA Refseq | NM_080608 |
Protein Refseq | NP_542175 |
MIM | 618936 |
UniProt ID | Q9BR10 |
◆ Recombinant Proteins | ||
SPATA25-8616M | Recombinant Mouse SPATA25 Protein, His (Fc)-Avi-tagged | +Inquiry |
SPATA25-3768H | Recombinant Human SPATA25 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RFL23831MF | Recombinant Full Length Mouse Spermatogenesis-Associated Protein 25(Spata25) Protein, His-Tagged | +Inquiry |
SPATA25-15829M | Recombinant Mouse SPATA25 Protein | +Inquiry |
SPATA25-2580H | Recombinant Human SPATA25 Protein, MYC/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SPATA25 Products
Required fields are marked with *
My Review for All SPATA25 Products
Required fields are marked with *