Recombinant Human SPATA25 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : SPATA25-3768H
Product Overview : C20orf165 MS Standard C13 and N15-labeled recombinant protein (NP_542175) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : SPATA25 (Spermatogenesis Associated 25) is a Protein Coding gene.
Molecular Mass : 23.8 kDa
AA Sequence : MSYFRTPQTHPGPLPSGQGGAASPGLSLGLCSPVEPVVVASGGTGPLSQKAEQVAPAAQAWGPALAMPQARGCPGGTSWETLRKEYSRNCHKFPHVRQLESLGWDNGYSRSRAPDLGGPSRPRPLMLCGLSPRVLPVPSEAVGKEASSQPDICILTLAMMIAGIPTVPVPGVREEDLIWAAQAFMMAHPEPEGAVEGARWEQAHAHTASGKMPLVRSKRGQPPGSCLTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name SPATA25 spermatogenesis associated 25 [ Homo sapiens (human) ]
Official Symbol SPATA25
Synonyms SPATA25; spermatogenesis associated 25; TSG23; C20orf165; dJ337O18.8; spermatogenesis-associated protein 25; testis-specific gene 23 protein
Gene ID 128497
mRNA Refseq NM_080608
Protein Refseq NP_542175
MIM 618936
UniProt ID Q9BR10

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SPATA25 Products

Required fields are marked with *

My Review for All SPATA25 Products

Required fields are marked with *

0
cart-icon
0
compare icon