Recombinant Human SPATA9 protein, His-tagged
Cat.No. : | SPATA9-7888H |
Product Overview : | Recombinant Human SPATA9 protein(), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
AASequence : | NFSGRIEGIQKAIMDLVDEFKDEFPTILRLSQSNQKREPAQKTSKIRMAIALAKINRATLIRGLNSISRSSKSVAKLLHPQLACRLLELRDISGRLLREVNAPRQPLYNIQVRKGSL |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | SPATA9 spermatogenesis associated 9 [ Homo sapiens ] |
Official Symbol | SPATA9 |
Synonyms | SPATA9; spermatogenesis associated 9; spermatogenesis-associated protein 9; FLJ35906; NYD SP16; testis development protein NYD-SP16; NYD-SP16; |
Gene ID | 83890 |
mRNA Refseq | NM_031952 |
Protein Refseq | NP_114158 |
MIM | 608039 |
UniProt ID | Q9BWV2 |
◆ Recombinant Proteins | ||
RFL16901HF | Recombinant Full Length Human Spermatogenesis-Associated Protein 9(Spata9) Protein, His-Tagged | +Inquiry |
SPATA9-15845M | Recombinant Mouse SPATA9 Protein | +Inquiry |
RFL30595MF | Recombinant Full Length Mouse Spermatogenesis-Associated Protein 9(Spata9) Protein, His-Tagged | +Inquiry |
SPATA9-8624M | Recombinant Mouse SPATA9 Protein, His (Fc)-Avi-tagged | +Inquiry |
SPATA9-7888H | Recombinant Human SPATA9 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SPATA9-1530HCL | Recombinant Human SPATA9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SPATA9 Products
Required fields are marked with *
My Review for All SPATA9 Products
Required fields are marked with *
0
Inquiry Basket