Recombinant Human SPEF2 protein, His-tagged
| Cat.No. : | SPEF2-3201H |
| Product Overview : | Recombinant Human SPEF2 protein, fused to His tag, was expressed in E. coli. |
| Availability | February 01, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | MALQKKKKSGLTGVEMQTMQRLTNLRLQNMKSDTFQERLRHMIPRQTDFNLMRITYRFQEKYKHVKEDLAHLHFEKLERFQKLKEEQRCFDIEKQYLNRRRQNEIMAKIQAAIIQIPKPASNRTLKALEAQKMMKKKKEAEDVADEIKKFEALIKKDLQAKESASKTSLDTAGQTTTDLLNTYSDDEYIKKIQKRLEEDAFAREQREKRRRKLLM |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | SPEF2 sperm flagellar 2 [ Homo sapiens ] |
| Official Symbol | SPEF2 |
| Synonyms | SPEF2; sperm flagellar 2; sperm flagellar protein 2; cancer/testis antigen 122; CT122; FLJ23577; KPL2; FLJ23164; FLJ25395; KIAA1770; MGC102842; |
| Gene ID | 79925 |
| mRNA Refseq | NM_024867 |
| Protein Refseq | NP_079143 |
| MIM | 610172 |
| UniProt ID | Q9C093 |
| ◆ Recombinant Proteins | ||
| SPEF2-6807Z | Recombinant Zebrafish SPEF2 | +Inquiry |
| SPEF2-5699R | Recombinant Rat SPEF2 Protein | +Inquiry |
| SPEF2-3201H | Recombinant Human SPEF2 protein, His-tagged | +Inquiry |
| SPEF2-5358R | Recombinant Rat SPEF2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| SPEF2-8635M | Recombinant Mouse SPEF2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SPEF2 Products
Required fields are marked with *
My Review for All SPEF2 Products
Required fields are marked with *
