Recombinant Human SPEG protein, GST-tagged
| Cat.No. : | SPEG-3520H |
| Product Overview : | Recombinant Human SPEG protein(Q15772)(1-113aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-113aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 38.7 kDa |
| AA Sequence : | MQKARGTRGEDAGTRAPPSPGVPPKRAKVGAGGGAPVAVAGAPVFLRPLKNAAVCAGSDVRLRVVVSGTPQPSLRWFRDGQLLPAPAPEPSCLWLRRCGAQDAGVYSCMAQNE |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | SPEG SPEG complex locus [ Homo sapiens ] |
| Official Symbol | SPEG |
| Synonyms | SPEG; SPEG complex locus; aortic preferentially expressed gene 1 , APEG1; striated muscle preferentially expressed protein kinase; BPEG; KIAA1297; MGC12676; SPEGalpha; SPEGbeta; aortic preferentially expressed gene 1; aortic preferentially expressed protein 1; nuclear protein, marker for differentiated aortic smooth muscle and down-regulated with vascular injury; APEG1; APEG-1; |
| Gene ID | 10290 |
| mRNA Refseq | NM_001173476 |
| Protein Refseq | NP_001166947 |
| UniProt ID | Q15772 |
| ◆ Recombinant Proteins | ||
| SPEG-2912H | Recombinant Human SPEG, GST-tagged | +Inquiry |
| SPEG-1118HF | Recombinant Full Length Human SPEG Protein, GST-tagged | +Inquiry |
| SPEG-1639Z | Recombinant Zebrafish SPEG | +Inquiry |
| SPEG-15868M | Recombinant Mouse SPEG Protein | +Inquiry |
| SPEG-5359R | Recombinant Rat SPEG Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SPEG-1680HCL | Recombinant Human SPEG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SPEG Products
Required fields are marked with *
My Review for All SPEG Products
Required fields are marked with *
