Recombinant Human SPG7 protein, His-tagged
| Cat.No. : | SPG7-2841H |
| Product Overview : | Recombinant Human SPG7 protein(362-406 aa), fused to His tag, was expressed in E. coli. |
| Availability | December 01, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 362-406 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | VATEAQVPFLAMAGPEFVEVIGGLGAARVRSLFKEARARAPCIVYI |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | SPG7 spastic paraplegia 7 (pure and complicated autosomal recessive) [ Homo sapiens ] |
| Official Symbol | SPG7 |
| Synonyms | SPG7; spastic paraplegia 7 (pure and complicated autosomal recessive); cell matrix adhesion regulator , CMAR; paraplegin; CAR; SPG5C; paraplegin, isoform 1; cell adhesion regulator; spastic paraplegia 7 protein; cell matrix adhesion regulator; PGN; CMAR; FLJ37308; MGC126331; MGC126332; |
| Gene ID | 6687 |
| mRNA Refseq | NM_003119 |
| Protein Refseq | NP_003110 |
| MIM | 602783 |
| UniProt ID | Q9UQ90 |
| ◆ Recombinant Proteins | ||
| RFL16878RF | Recombinant Full Length Rat Paraplegin(Spg7) Protein, His-Tagged | +Inquiry |
| SPG7-2841H | Recombinant Human SPG7 protein, His-tagged | +Inquiry |
| SPG7-490HF | Recombinant Full Length Human SPG7 Protein, GST-tagged | +Inquiry |
| RFL20563MF | Recombinant Full Length Mouse Paraplegin(Spg7) Protein, His-Tagged | +Inquiry |
| SPG7-1902C | Recombinant Chicken SPG7 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SPG7-1518HCL | Recombinant Human SPG7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SPG7 Products
Required fields are marked with *
My Review for All SPG7 Products
Required fields are marked with *
