Recombinant Human SPIN4 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | SPIN4-2041H |
| Product Overview : | SPIN4 MS Standard C13 and N15-labeled recombinant protein (NP_001012986) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | Exhibits H3K4me3-binding activity |
| Molecular Mass : | 28.7 kDa |
| AA Sequence : | MSPPTVPPMGVDGVSAYLMKKRHTHRKQRRKPTFLTRRNIVGCRIQHGWKEGNEPVEQWKGTVLEQVSVKPTLYIIKYDGKDSVYGLELHRDKRVLALEILPERVPTPRIDSRLADSLIGKAVEHVFEGEHGTKDEWKGMVLARAPVMDTWFYITYEKDPVLYMYTLLDDYKDGDLRIIPDSNYYFPTAEQEPGEVVDSLVGKQVEHAKDDGSKRTGIFIHQVVAKPSVYFIKFDDDIHIYVYGLVKTPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | SPIN4 spindlin family member 4 [ Homo sapiens (human) ] |
| Official Symbol | SPIN4 |
| Synonyms | SPIN4; spindlin family, member 4; TDRD28; spindlin-4 |
| Gene ID | 139886 |
| mRNA Refseq | NM_001012968 |
| Protein Refseq | NP_001012986 |
| UniProt ID | Q56A73 |
| ◆ Recombinant Proteins | ||
| Spin4-6095M | Recombinant Mouse Spin4 Protein, Myc/DDK-tagged | +Inquiry |
| SPIN4-0475H | Recombinant Human SPIN4 Protein (S2-P249), Tag Free | +Inquiry |
| SPIN4-2041H | Recombinant Human SPIN4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| SPIN4-0474H | Recombinant Human SPIN4 Protein (S2-P249), His tagged | +Inquiry |
| SPIN4-2474H | Recombinant Human SPIN4 protein(36-249aa), GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SPIN4-1512HCL | Recombinant Human SPIN4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SPIN4 Products
Required fields are marked with *
My Review for All SPIN4 Products
Required fields are marked with *



