Recombinant Human SPIN4 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | SPIN4-2041H |
Product Overview : | SPIN4 MS Standard C13 and N15-labeled recombinant protein (NP_001012986) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Exhibits H3K4me3-binding activity |
Molecular Mass : | 28.7 kDa |
AA Sequence : | MSPPTVPPMGVDGVSAYLMKKRHTHRKQRRKPTFLTRRNIVGCRIQHGWKEGNEPVEQWKGTVLEQVSVKPTLYIIKYDGKDSVYGLELHRDKRVLALEILPERVPTPRIDSRLADSLIGKAVEHVFEGEHGTKDEWKGMVLARAPVMDTWFYITYEKDPVLYMYTLLDDYKDGDLRIIPDSNYYFPTAEQEPGEVVDSLVGKQVEHAKDDGSKRTGIFIHQVVAKPSVYFIKFDDDIHIYVYGLVKTPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | SPIN4 spindlin family member 4 [ Homo sapiens (human) ] |
Official Symbol | SPIN4 |
Synonyms | SPIN4; spindlin family, member 4; TDRD28; spindlin-4 |
Gene ID | 139886 |
mRNA Refseq | NM_001012968 |
Protein Refseq | NP_001012986 |
UniProt ID | Q56A73 |
◆ Recombinant Proteins | ||
SPIN4-8647M | Recombinant Mouse SPIN4 Protein, His (Fc)-Avi-tagged | +Inquiry |
Spin4-6095M | Recombinant Mouse Spin4 Protein, Myc/DDK-tagged | +Inquiry |
SPIN4-5374H | Recombinant Human SPIN4 protein(36-249aa), His-tagged | +Inquiry |
SPIN4-0475H | Recombinant Human SPIN4 Protein (S2-P249), Tag Free | +Inquiry |
SPIN4-15884M | Recombinant Mouse SPIN4 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SPIN4-1512HCL | Recombinant Human SPIN4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SPIN4 Products
Required fields are marked with *
My Review for All SPIN4 Products
Required fields are marked with *