Recombinant Human SPIN4 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: SPIN4-2041H
• Product Overview: SPIN4 MS Standard C13 and N15-labeled recombinant protein (NP_001012986) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: Exhibits H3K4me3-binding activity
• Molecular Mass: 28.7 kDa
• AA Sequence: MSPPTVPPMGVDGVSAYLMKKRHTHRKQRRKPTFLTRRNIVGCRIQHGWKEGNEPVEQWKGTVLEQVSVKPTLYIIKYDGKDSVYGLELHRDKRVLALEILPERVPTPRIDSRLADSLIGKAVEHVFEGEHGTKDEWKGMVLARAPVMDTWFYITYEKDPVLYMYTLLDDYKDGDLRIIPDSNYYFPTAEQEPGEVVDSLVGKQVEHAKDDGSKRTGIFIHQVVAKPSVYFIKFDDDIHIYVYGLVKTPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: SPIN4 spindlin family member 4 [ Homo sapiens (human) ]
• Official Symbol: SPIN4
• Synonyms: SPIN4; spindlin family, member 4; TDRD28; spindlin-4
• Gene ID: 139886
• mRNA Refseq: NM_001012968
• Protein Refseq: NP_001012986
• UniProt ID: Q56A73