Recombinant Human SPINK7 Protein, GST-tagged

Cat.No. : SPINK7-4045H
Product Overview : Human ECG2 full-length ORF ( NP_115955.1, 1 a.a. - 85 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : SPINK7 (Serine Peptidase Inhibitor, Kazal Type 7 (Putative)) is a Protein Coding gene. Diseases associated with SPINK7 include Esophageal Cancer. GO annotations related to this gene include serine-type endopeptidase inhibitor activity. An important paralog of this gene is SPINK14.
Molecular Mass : 35.6 kDa
AA Sequence : MKITGGLLLLCTVVYFCSSSEAASLSPKKVDCSIYKKYPVVAIPCPITYLPVCGSDYITYGNECHLCTESLKSNGRVQFLHDGSC
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name SPINK7 serine peptidase inhibitor, Kazal type 7 (putative) [ Homo sapiens ]
Official Symbol SPINK7
Synonyms ECG2; ECRG2
Gene ID 84651
mRNA Refseq NM_032566
Protein Refseq NP_115955
MIM 617288
UniProt ID P58062

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SPINK7 Products

Required fields are marked with *

My Review for All SPINK7 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon