Recombinant Human SPINK7 Protein, GST-tagged
Cat.No. : | SPINK7-4045H |
Product Overview : | Human ECG2 full-length ORF ( NP_115955.1, 1 a.a. - 85 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | SPINK7 (Serine Peptidase Inhibitor, Kazal Type 7 (Putative)) is a Protein Coding gene. Diseases associated with SPINK7 include Esophageal Cancer. GO annotations related to this gene include serine-type endopeptidase inhibitor activity. An important paralog of this gene is SPINK14. |
Molecular Mass : | 35.6 kDa |
AA Sequence : | MKITGGLLLLCTVVYFCSSSEAASLSPKKVDCSIYKKYPVVAIPCPITYLPVCGSDYITYGNECHLCTESLKSNGRVQFLHDGSC |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | SPINK7 serine peptidase inhibitor, Kazal type 7 (putative) [ Homo sapiens ] |
Official Symbol | SPINK7 |
Synonyms | ECG2; ECRG2 |
Gene ID | 84651 |
mRNA Refseq | NM_032566 |
Protein Refseq | NP_115955 |
MIM | 617288 |
UniProt ID | P58062 |
◆ Recombinant Proteins | ||
Spink7-6097M | Recombinant Mouse Spink7 Protein, Myc/DDK-tagged | +Inquiry |
SPINK7-4012H | Recombinant Human SPINK7 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SPINK7-206H | Recombinant Human serine peptidase inhibitor, Kazal type 7 (putative), His-tagged | +Inquiry |
SPINK7-4746HF | Recombinant Full Length Human SPINK7 Protein, GST-tagged | +Inquiry |
SPINK7-0331C | Recombinant Chicken SPINK7 Protein (Ala25-Cys210), N-His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SPINK7-1509HCL | Recombinant Human SPINK7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SPINK7 Products
Required fields are marked with *
My Review for All SPINK7 Products
Required fields are marked with *
0
Inquiry Basket