Recombinant Human SPINK7 Protein, GST-tagged

• Cat.No.: SPINK7-4045H
• Product Overview: Human ECG2 full-length ORF ( NP_115955.1, 1 a.a. - 85 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: SPINK7 (Serine Peptidase Inhibitor, Kazal Type 7 (Putative)) is a Protein Coding gene. Diseases associated with SPINK7 include Esophageal Cancer. GO annotations related to this gene include serine-type endopeptidase inhibitor activity. An important paralog of this gene is SPINK14.
• Molecular Mass: 35.6 kDa
• AA Sequence: MKITGGLLLLCTVVYFCSSSEAASLSPKKVDCSIYKKYPVVAIPCPITYLPVCGSDYITYGNECHLCTESLKSNGRVQFLHDGSC
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: SPINK7 serine peptidase inhibitor, Kazal type 7 (putative) [ Homo sapiens ]
• Official Symbol: SPINK7
• Synonyms: ECG2; ECRG2
• Gene ID: 84651
• mRNA Refseq: NM_032566
• Protein Refseq: NP_115955
• MIM: 617288
• UniProt ID: P58062