Recombinant Human SPINLW1 protein, GST-tagged
Cat.No. : | SPINLW1-326H |
Product Overview : | Recombinant Human SPINLW1(22 a.a. - 133 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 22-133 a.a. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 38.06 kDa |
AA Sequence : | PGLTDWLFPRRCPKIREECEFQERDVCTKDRQCQDNKKCCVFSCGKKCLDLKQDVCEMPKETGPCLAYFLHWWYD KKDNTCSMFVYGGCQGNNNNFQSKANCLNTCKNKRFP |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Gene Name | SPINLW1 serine peptidase inhibitor-like, with Kunitz and WAP domains 1 (eppin) [ Homo sapiens ] |
Official Symbol | SPINLW1 |
Synonyms | SPINLW1; serine peptidase inhibitor-like, with Kunitz and WAP domains 1 (eppin); serine protease inhibitor like, with Kunitz and WAP domains 1 (eppin); eppin; cancer/testis antigen 72; CT72; dJ461P17.2; epididymal protease inhibitor; EPPIN; EPPIN1; EPPIN2; EPPIN3; WAP7; WFDC7; protease inhibitor WAP7; cancer/testis antigen 71; WAP four-disulfide core domain protein 7; CT71; |
Gene ID | 57119 |
mRNA Refseq | NM_020398 |
Protein Refseq | NP_065131 |
MIM | 609031 |
UniProt ID | O95925 |
Chromosome Location | 20q12-q13.2 |
Function | peptidase inhibitor activity; serine-type endopeptidase inhibitor activity; |
◆ Recombinant Proteins | ||
SPINLW1-4254R | Recombinant Rhesus Macaque SPINLW1 Protein, His (Fc)-Avi-tagged | +Inquiry |
SPINLW1-325H | Recombinant Human SPINLW1 protein, GST-tagged | +Inquiry |
SPINLW1-646HF | Recombinant Full Length Human SPINLW1 Protein, GST-tagged | +Inquiry |
SPINLW1-2920H | Recombinant Human SPINLW1, His-tagged | +Inquiry |
SPINLW1-326H | Recombinant Human SPINLW1 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SPINLW1-1508HCL | Recombinant Human SPINLW1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SPINLW1 Products
Required fields are marked with *
My Review for All SPINLW1 Products
Required fields are marked with *
0
Inquiry Basket