Recombinant Human SPINLW1 protein, GST-tagged

Cat.No. : SPINLW1-326H
Product Overview : Recombinant Human SPINLW1(22 a.a. - 133 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 22-133 a.a.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 38.06 kDa
AA Sequence : PGLTDWLFPRRCPKIREECEFQERDVCTKDRQCQDNKKCCVFSCGKKCLDLKQDVCEMPKETGPCLAYFLHWWYD KKDNTCSMFVYGGCQGNNNNFQSKANCLNTCKNKRFP
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Gene Name SPINLW1 serine peptidase inhibitor-like, with Kunitz and WAP domains 1 (eppin) [ Homo sapiens ]
Official Symbol SPINLW1
Synonyms SPINLW1; serine peptidase inhibitor-like, with Kunitz and WAP domains 1 (eppin); serine protease inhibitor like, with Kunitz and WAP domains 1 (eppin); eppin; cancer/testis antigen 72; CT72; dJ461P17.2; epididymal protease inhibitor; EPPIN; EPPIN1; EPPIN2; EPPIN3; WAP7; WFDC7; protease inhibitor WAP7; cancer/testis antigen 71; WAP four-disulfide core domain protein 7; CT71;
Gene ID 57119
mRNA Refseq NM_020398
Protein Refseq NP_065131
MIM 609031
UniProt ID O95925
Chromosome Location 20q12-q13.2
Function peptidase inhibitor activity; serine-type endopeptidase inhibitor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SPINLW1 Products

Required fields are marked with *

My Review for All SPINLW1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon