Recombinant Human SPINT4 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : SPINT4-6529H
Product Overview : SPINT4 MS Standard C13 and N15-labeled recombinant protein (NP_848550) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : SPINT4 (Serine Peptidase Inhibitor, Kunitz Type 4) is a Protein Coding gene. Gene Ontology (GO) annotations related to this gene include serine-type endopeptidase inhibitor activity. An important paralog of this gene is TFPI2.
Molecular Mass : 11.2 kDa
AA Sequence : MKSAKLGFLLRFFIFCSLNTLLLGGVNKIAEKICGDLKDPCKLDMNFGSCYEVHFRYFYNRTSKRCETFVFSGCNGNLNNFKLKIEREVACVAKYKPPRTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name SPINT4 serine peptidase inhibitor, Kunitz type 4 [ Homo sapiens (human) ]
Official Symbol SPINT4
Synonyms SPINT4; serine peptidase inhibitor, Kunitz type 4; SPINT3; C20orf137; dJ601O1.1; kunitz-type protease inhibitor 4; epididymis secretory sperm binding protein; serine protease inhibitor, Kunitz type 1; serine protease inhibitor, Kunitz type 4
Gene ID 391253
mRNA Refseq NM_178455
Protein Refseq NP_848550
UniProt ID Q6UDR6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SPINT4 Products

Required fields are marked with *

My Review for All SPINT4 Products

Required fields are marked with *

0
cart-icon
0
compare icon