Recombinant Human SPINT4 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | SPINT4-6529H |
Product Overview : | SPINT4 MS Standard C13 and N15-labeled recombinant protein (NP_848550) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | SPINT4 (Serine Peptidase Inhibitor, Kunitz Type 4) is a Protein Coding gene. Gene Ontology (GO) annotations related to this gene include serine-type endopeptidase inhibitor activity. An important paralog of this gene is TFPI2. |
Molecular Mass : | 11.2 kDa |
AA Sequence : | MKSAKLGFLLRFFIFCSLNTLLLGGVNKIAEKICGDLKDPCKLDMNFGSCYEVHFRYFYNRTSKRCETFVFSGCNGNLNNFKLKIEREVACVAKYKPPRTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | SPINT4 serine peptidase inhibitor, Kunitz type 4 [ Homo sapiens (human) ] |
Official Symbol | SPINT4 |
Synonyms | SPINT4; serine peptidase inhibitor, Kunitz type 4; SPINT3; C20orf137; dJ601O1.1; kunitz-type protease inhibitor 4; epididymis secretory sperm binding protein; serine protease inhibitor, Kunitz type 1; serine protease inhibitor, Kunitz type 4 |
Gene ID | 391253 |
mRNA Refseq | NM_178455 |
Protein Refseq | NP_848550 |
UniProt ID | Q6UDR6 |
◆ Recombinant Proteins | ||
SPINT4-2689H | Recombinant Human SPINT4 Protein, MYC/DDK-tagged | +Inquiry |
SPINT4-15900M | Recombinant Mouse SPINT4 Protein | +Inquiry |
SPINT4-6529H | Recombinant Human SPINT4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SPINT4-8660M | Recombinant Mouse SPINT4 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SPINT4 Products
Required fields are marked with *
My Review for All SPINT4 Products
Required fields are marked with *