Recombinant Human SPOCK2 protein, GST-tagged
Cat.No. : | SPOCK2-2927H |
Product Overview : | Recombinant Human SPOCK2 protein(293-340 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E. coli |
Tag : | GST |
Protein Length : | 293-340 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
AASequence : | KDGRVSTAEWCFCFWREKPPCLAELERIQIQEAAKKKPGIFIPSCDED |
Purity : | 85%, by SDS-PAGE. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
Gene Name | SPOCK2 sparc/osteonectin, cwcv and kazal-like domains proteoglycan (testican) 2 [ Homo sapiens ] |
Official Symbol | SPOCK2 |
Synonyms | SPOCK2; sparc/osteonectin, cwcv and kazal-like domains proteoglycan (testican) 2; testican-2; KIAA0275; testican 2; SPARC/osteonectin, CWCV, and Kazal-like domains proteoglycan 2; FLJ97039; |
mRNA Refseq | NM_001134434 |
Protein Refseq | NP_001127906 |
MIM | 607988 |
UniProt ID | Q92563 |
Gene ID | 9806 |
◆ Recombinant Proteins | ||
SPOCK2-8666M | Recombinant Mouse SPOCK2 Protein, His (Fc)-Avi-tagged | +Inquiry |
SPOCK2-2682H | Recombinant Human SPOCK2 Protein, MYC/DDK-tagged | +Inquiry |
SPOCK2-2727H | Recombinant Human SPOCK2 Protein, His-tagged | +Inquiry |
SPOCK2-15916M | Recombinant Mouse SPOCK2 Protein | +Inquiry |
SPOCK2-2926H | Recombinant Human SPOCK2 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SPOCK2-1685HCL | Recombinant Human SPOCK2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SPOCK2 Products
Required fields are marked with *
My Review for All SPOCK2 Products
Required fields are marked with *