Recombinant Human SPPL2C Protein, GST-tagged

Cat.No. : SPPL2C-5145H
Product Overview : Human IMP5 partial ORF ( NP_787078, 29 a.a. - 122 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : SPPL2C (Signal Peptide Peptidase Like 2C) is a Protein Coding gene. GO annotations related to this gene include protein homodimerization activity and aspartic-type endopeptidase activity. An important paralog of this gene is SPPL2B.
Molecular Mass : 36.08 kDa
AA Sequence : VVSENWSKDYCILFSSDYITLPRDLHHAPLLPLYDGTKAPWCPGEDSPHQAQLRSPSQRPLRQTTAMVMRGNCSFHTKGWLAQGQGAHGLLIVS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name SPPL2C signal peptide peptidase like 2C [ Homo sapiens (human) ]
Official Symbol SPPL2C
Synonyms SPPL2C; signal peptide peptidase like 2C; IMP5; signal peptide peptidase-like 2C; IMP-5
SPP-like 2C; intramembrane protease 5
Gene ID 162540
mRNA Refseq NM_175882
Protein Refseq NP_787078
MIM 608284
UniProt ID Q8IUH8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SPPL2C Products

Required fields are marked with *

My Review for All SPPL2C Products

Required fields are marked with *

0
cart-icon
0
compare icon