Recombinant Human SPPL2C Protein, GST-tagged

• Cat.No.: SPPL2C-5145H
• Product Overview: Human IMP5 partial ORF ( NP_787078, 29 a.a. - 122 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: SPPL2C (Signal Peptide Peptidase Like 2C) is a Protein Coding gene. GO annotations related to this gene include protein homodimerization activity and aspartic-type endopeptidase activity. An important paralog of this gene is SPPL2B.
• Molecular Mass: 36.08 kDa
• AA Sequence: VVSENWSKDYCILFSSDYITLPRDLHHAPLLPLYDGTKAPWCPGEDSPHQAQLRSPSQRPLRQTTAMVMRGNCSFHTKGWLAQGQGAHGLLIVS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: SPPL2C signal peptide peptidase like 2C [ Homo sapiens (human) ]
• Official Symbol: SPPL2C
• Synonyms: SPPL2C; signal peptide peptidase like 2C; IMP5; signal peptide peptidase-like 2C; IMP-5
  SPP-like 2C; intramembrane protease 5
• Gene ID: 162540
• mRNA Refseq: NM_175882
• Protein Refseq: NP_787078
• MIM: 608284
• UniProt ID: Q8IUH8