Recombinant Human SPR, His-tagged
Cat.No. : | SPR-30400TH |
Product Overview : | Recombinant full length Human SPR with N terminal His tag; 281 aa, 30.2 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 261 amino acids |
Description : | This gene encodes an aldo-keto reductase that catalyzes the NADPH-dependent reduction of pteridine derivatives and is important in the biosynthesis of tetrahydrobiopterin (BH4). Mutations in this gene result in DOPA-responsive dystonia due to sepiaterin reductase deficiency. A pseudogene has been identified on chromosome 1. |
Conjugation : | HIS |
Molecular Weight : | 30.200kDa inclusive of tags |
Form : | Liquid |
Purity : | >95% by SDS-PAGE |
Storage buffer : | pH: 8.00Constituent:0.32% Tris HCl |
Storage : | Please see Notes section |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMEGGLGRAVCLLTGASRGFG RTLAPLLASLLSPGSVLVLSARNDEALRQLEAELGAERSG LRVVRVPADLGAEAGLQQLLGALRELPRPKGLQRLLLINN AGSLGDVSKGFVDLSDSTQVNNYWALNLTSMLCLTSSVLK AFPDSPGLNRTVVNISSLCALQPFKGWALYCAGKAARDML FQVLALEEPNVRVLNYAPGPLDTDMQQLARETSVDPDMRK GLQELKAKGKLVDCKVSAQKLLSLLEKDEFKSGAHVDFYD K |
Sequence Similarities : | Belongs to the sepiapterin reductase family. |
Gene Name | SPR sepiapterin reductase (7,8-dihydrobiopterin:NADP+ oxidoreductase) [ Homo sapiens ] |
Official Symbol | SPR |
Synonyms | SPR; sepiapterin reductase (7,8-dihydrobiopterin:NADP+ oxidoreductase); sepiapterin reductase; SDR38C1; short chain dehydrogenase/reductase family 38C; member 1; |
Gene ID | 6697 |
mRNA Refseq | NM_003124 |
Protein Refseq | NP_003115 |
MIM | 182125 |
Uniprot ID | P35270 |
Chromosome Location | 2p14-p12 |
Pathway | Folate biosynthesis, organism-specific biosystem; Folate biosynthesis, conserved biosystem; Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of nitric oxide, organism-specific biosystem; |
Function | NADP binding; aldo-keto reductase (NADP) activity; oxidoreductase activity; sepiapterin reductase activity; |
◆ Recombinant Proteins | ||
SPR-2090H | Recombinant Human SPR Protein, His (Fc)-Avi-tagged | +Inquiry |
Spr-682M | Recombinant Mouse Spr Protein, His-tagged | +Inquiry |
SPR-4262R | Recombinant Rhesus Macaque SPR Protein, His (Fc)-Avi-tagged | +Inquiry |
SPR-1089HFL | Recombinant Full Length Human SPR Protein, C-Flag-tagged | +Inquiry |
SPR-681H | Recombinant Human SPR Protein, His/GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SPR-1499HCL | Recombinant Human SPR 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SPR Products
Required fields are marked with *
My Review for All SPR Products
Required fields are marked with *
0
Inquiry Basket