Recombinant Human SPR, His-tagged
| Cat.No. : | SPR-30400TH | 
| Product Overview : | Recombinant full length Human SPR with N terminal His tag; 281 aa, 30.2 kDa. | 
- Specification
 - Gene Information
 - Related Products
 - Download
 
| Species : | Human | 
| Source : | E.coli | 
| Tag : | His | 
| Protein Length : | 261 amino acids | 
| Description : | This gene encodes an aldo-keto reductase that catalyzes the NADPH-dependent reduction of pteridine derivatives and is important in the biosynthesis of tetrahydrobiopterin (BH4). Mutations in this gene result in DOPA-responsive dystonia due to sepiaterin reductase deficiency. A pseudogene has been identified on chromosome 1. | 
| Conjugation : | HIS | 
| Molecular Weight : | 30.200kDa inclusive of tags | 
| Form : | Liquid | 
| Purity : | >95% by SDS-PAGE | 
| Storage buffer : | pH: 8.00Constituent:0.32% Tris HCl | 
| Storage : | Please see Notes section | 
| Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMEGGLGRAVCLLTGASRGFG RTLAPLLASLLSPGSVLVLSARNDEALRQLEAELGAERSG LRVVRVPADLGAEAGLQQLLGALRELPRPKGLQRLLLINN AGSLGDVSKGFVDLSDSTQVNNYWALNLTSMLCLTSSVLK AFPDSPGLNRTVVNISSLCALQPFKGWALYCAGKAARDML FQVLALEEPNVRVLNYAPGPLDTDMQQLARETSVDPDMRK GLQELKAKGKLVDCKVSAQKLLSLLEKDEFKSGAHVDFYD K | 
| Sequence Similarities : | Belongs to the sepiapterin reductase family. | 
| Gene Name | SPR sepiapterin reductase (7,8-dihydrobiopterin:NADP+ oxidoreductase) [ Homo sapiens ] | 
| Official Symbol | SPR | 
| Synonyms | SPR; sepiapterin reductase (7,8-dihydrobiopterin:NADP+ oxidoreductase); sepiapterin reductase; SDR38C1; short chain dehydrogenase/reductase family 38C; member 1; | 
| Gene ID | 6697 | 
| mRNA Refseq | NM_003124 | 
| Protein Refseq | NP_003115 | 
| MIM | 182125 | 
| Uniprot ID | P35270 | 
| Chromosome Location | 2p14-p12 | 
| Pathway | Folate biosynthesis, organism-specific biosystem; Folate biosynthesis, conserved biosystem; Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of nitric oxide, organism-specific biosystem; | 
| Function | NADP binding; aldo-keto reductase (NADP) activity; oxidoreductase activity; sepiapterin reductase activity; | 
| ◆ Recombinant Proteins | ||
| SPR-30400TH | Recombinant Human SPR, His-tagged | +Inquiry | 
| SPR-3654H | Recombinant Human SPR protein, His-tagged | +Inquiry | 
| SPR-2931H | Recombinant Human SPR, GST-tagged | +Inquiry | 
| Spr-6107M | Recombinant Mouse Spr Protein, Myc/DDK-tagged | +Inquiry | 
| SPR-1089HFL | Recombinant Full Length Human SPR Protein, C-Flag-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| SPR-1499HCL | Recombinant Human SPR 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
 - Q&As (0)
 
Ask a Question for All SPR Products
Required fields are marked with *
My Review for All SPR Products
Required fields are marked with *
  
        
    
      
            