Recombinant Human SPR, His-tagged
| Cat.No. : | SPR-30400TH |
| Product Overview : | Recombinant full length Human SPR with N terminal His tag; 281 aa, 30.2 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 261 amino acids |
| Description : | This gene encodes an aldo-keto reductase that catalyzes the NADPH-dependent reduction of pteridine derivatives and is important in the biosynthesis of tetrahydrobiopterin (BH4). Mutations in this gene result in DOPA-responsive dystonia due to sepiaterin reductase deficiency. A pseudogene has been identified on chromosome 1. |
| Conjugation : | HIS |
| Molecular Weight : | 30.200kDa inclusive of tags |
| Form : | Liquid |
| Purity : | >95% by SDS-PAGE |
| Storage buffer : | pH: 8.00Constituent:0.32% Tris HCl |
| Storage : | Please see Notes section |
| Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMEGGLGRAVCLLTGASRGFG RTLAPLLASLLSPGSVLVLSARNDEALRQLEAELGAERSG LRVVRVPADLGAEAGLQQLLGALRELPRPKGLQRLLLINN AGSLGDVSKGFVDLSDSTQVNNYWALNLTSMLCLTSSVLK AFPDSPGLNRTVVNISSLCALQPFKGWALYCAGKAARDML FQVLALEEPNVRVLNYAPGPLDTDMQQLARETSVDPDMRK GLQELKAKGKLVDCKVSAQKLLSLLEKDEFKSGAHVDFYD K |
| Sequence Similarities : | Belongs to the sepiapterin reductase family. |
| Gene Name | SPR sepiapterin reductase (7,8-dihydrobiopterin:NADP+ oxidoreductase) [ Homo sapiens ] |
| Official Symbol | SPR |
| Synonyms | SPR; sepiapterin reductase (7,8-dihydrobiopterin:NADP+ oxidoreductase); sepiapterin reductase; SDR38C1; short chain dehydrogenase/reductase family 38C; member 1; |
| Gene ID | 6697 |
| mRNA Refseq | NM_003124 |
| Protein Refseq | NP_003115 |
| MIM | 182125 |
| Uniprot ID | P35270 |
| Chromosome Location | 2p14-p12 |
| Pathway | Folate biosynthesis, organism-specific biosystem; Folate biosynthesis, conserved biosystem; Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of nitric oxide, organism-specific biosystem; |
| Function | NADP binding; aldo-keto reductase (NADP) activity; oxidoreductase activity; sepiapterin reductase activity; |
| ◆ Recombinant Proteins | ||
| SPR-2931H | Recombinant Human SPR, GST-tagged | +Inquiry |
| Spr-6107M | Recombinant Mouse Spr Protein, Myc/DDK-tagged | +Inquiry |
| SPR-190H | Recombinant Full Length Human Sepiapterin Reductase, His-tagged | +Inquiry |
| SPR-4607H | Recombinant Human SPR protein, MBP-His-Avi-tagged, Biotinylated | +Inquiry |
| SPR-30401TH | Recombinant Human SPR, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SPR-1499HCL | Recombinant Human SPR 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SPR Products
Required fields are marked with *
My Review for All SPR Products
Required fields are marked with *
