Recombinant Human SPRED2 Protein, His tagged
Cat.No. : | SPRED2-001H |
Product Overview : | Recombinant Human SPRED2 Protein (117-297 aa) with His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E. coli |
Tag : | His |
Protein Length : | 117-297 aa |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Sterile PBS, pH7.4 |
AA Sequence : | MKAIEDLIEGSTTSSSTIHNEAELGDDDVFTTATDSSSNSSQKREQPTRTISSPTSCEHRRIYTLGHLHDSYPTDHYHLDQPMPRPYRQVSFPDDDEEIVRINPREKIWMTGYEDYRHAPVRGKYPDPSEDADSSYVRFAKGEVPKHDYNYPYVDSSDFGLGEDPKGRGGSVIKTQPSRGKSHHHHHHHH |
Endotoxin : | <1 EU/μg by LAL |
Purity : | > 90% by SDS-PAGE |
Concentration : | 1 mg/mL by BCA |
Official Symbol | SPRED2 |
Synonyms | SPRED2; sprouty-related, EVH1 domain containing 2; sprouty-related, EVH1 domain-containing protein 2; FLJ21897; FLJ31917; Spred 2; sprouty protein with EVH-1 domain 2, related sequence; Spred-2; MGC163164; |
Gene ID | 200734 |
mRNA Refseq | NM_001128210 |
Protein Refseq | NP_001121682 |
MIM | 609292 |
UniProt ID | Q7Z698 |
◆ Recombinant Proteins | ||
SPRED2-1802H | Recombinant Human SPRED2 protein, His & T7-tagged | +Inquiry |
SPRED2-4448R | Recombinant Rhesus monkey SPRED2 Protein, His-tagged | +Inquiry |
SPRED2-8675M | Recombinant Mouse SPRED2 Protein, His (Fc)-Avi-tagged | +Inquiry |
SPRED2-15926M | Recombinant Mouse SPRED2 Protein | +Inquiry |
SPRED2-5381R | Recombinant Rat SPRED2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
SPRED2-001H | Recombinant Human SPRED2 Protein, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SPRED2-1497HCL | Recombinant Human SPRED2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SPRED2 Products
Required fields are marked with *
My Review for All SPRED2 Products
Required fields are marked with *
0
Inquiry Basket