Recombinant Human SPRED2 Protein, His tagged

Cat.No. : SPRED2-001H
Product Overview : Recombinant Human SPRED2 Protein (117-297 aa) with His tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E. coli
Tag : His
Protein Length : 117-297 aa
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Storage Buffer : Sterile PBS, pH7.4
AA Sequence : MKAIEDLIEGSTTSSSTIHNEAELGDDDVFTTATDSSSNSSQKREQPTRTISSPTSCEHRRIYTLGHLHDSYPTDHYHLDQPMPRPYRQVSFPDDDEEIVRINPREKIWMTGYEDYRHAPVRGKYPDPSEDADSSYVRFAKGEVPKHDYNYPYVDSSDFGLGEDPKGRGGSVIKTQPSRGKSHHHHHHHH
Endotoxin : <1 EU/μg by LAL
Purity : > 90% by SDS-PAGE
Concentration : 1 mg/mL by BCA
Official Symbol SPRED2
Synonyms SPRED2; sprouty-related, EVH1 domain containing 2; sprouty-related, EVH1 domain-containing protein 2; FLJ21897; FLJ31917; Spred 2; sprouty protein with EVH-1 domain 2, related sequence; Spred-2; MGC163164;
Gene ID 200734
mRNA Refseq NM_001128210
Protein Refseq NP_001121682
MIM 609292
UniProt ID Q7Z698

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SPRED2 Products

Required fields are marked with *

My Review for All SPRED2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon