Recombinant Human SPRR1A Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : SPRR1A-2780H
Product Overview : SPRR1A MS Standard C13 and N15-labeled recombinant protein (NP_005978) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Cross-linked envelope protein of keratinocytes. It is a keratinocyte protein that first appears in the cell cytosol, but ultimately becomes cross-linked to membrane proteins by transglutaminase. All that results in the formation of an insoluble envelope beneath the plasma membrane.
Molecular Mass : 9.9 kDa
AA Sequence : MNSQQQKQPCTPPPQPQQQQVKQPCQPPPQEPCIPKTKEPCQPKVPEPCHPKVPEPCQPKIPEPCQPKVPEPCPSTVTPAPAQQKTKQKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name SPRR1A small proline rich protein 1A [ Homo sapiens (human) ]
Official Symbol SPRR1A
Synonyms SPRR1A; small proline rich protein 1A; SPRK; cornifin-A; 19 kDa pancornulin; SPR-IA; small proline-rich protein IA
Gene ID 6698
mRNA Refseq NM_005987
Protein Refseq NP_005978
MIM 182265
UniProt ID P35321

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SPRR1A Products

Required fields are marked with *

My Review for All SPRR1A Products

Required fields are marked with *

0
cart-icon