Recombinant Human SPRR1A Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | SPRR1A-2780H |
Product Overview : | SPRR1A MS Standard C13 and N15-labeled recombinant protein (NP_005978) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Cross-linked envelope protein of keratinocytes. It is a keratinocyte protein that first appears in the cell cytosol, but ultimately becomes cross-linked to membrane proteins by transglutaminase. All that results in the formation of an insoluble envelope beneath the plasma membrane. |
Molecular Mass : | 9.9 kDa |
AA Sequence : | MNSQQQKQPCTPPPQPQQQQVKQPCQPPPQEPCIPKTKEPCQPKVPEPCHPKVPEPCQPKIPEPCQPKVPEPCPSTVTPAPAQQKTKQKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | SPRR1A small proline rich protein 1A [ Homo sapiens (human) ] |
Official Symbol | SPRR1A |
Synonyms | SPRR1A; small proline rich protein 1A; SPRK; cornifin-A; 19 kDa pancornulin; SPR-IA; small proline-rich protein IA |
Gene ID | 6698 |
mRNA Refseq | NM_005987 |
Protein Refseq | NP_005978 |
MIM | 182265 |
UniProt ID | P35321 |
◆ Recombinant Proteins | ||
SPRR1A-2932H | Recombinant Human SPRR1A, His-tagged | +Inquiry |
SPRR1A-1114H | Recombinant Human SPRR1A protein, His&Myc-tagged | +Inquiry |
SPRR1A-4139H | Recombinant Human SPRR1A Protein, His (Fc)-Avi-tagged | +Inquiry |
SPRR1A-8678M | Recombinant Mouse SPRR1A Protein, His (Fc)-Avi-tagged | +Inquiry |
SPRR1A-2728H | Recombinant Human SPRR1A Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SPRR1A-1495HCL | Recombinant Human SPRR1A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SPRR1A Products
Required fields are marked with *
My Review for All SPRR1A Products
Required fields are marked with *
0
Inquiry Basket