Recombinant Human SPRR1A Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: SPRR1A-2780H
• Product Overview: SPRR1A MS Standard C13 and N15-labeled recombinant protein (NP_005978) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: Cross-linked envelope protein of keratinocytes. It is a keratinocyte protein that first appears in the cell cytosol, but ultimately becomes cross-linked to membrane proteins by transglutaminase. All that results in the formation of an insoluble envelope beneath the plasma membrane.
• Molecular Mass: 9.9 kDa
• AA Sequence: MNSQQQKQPCTPPPQPQQQQVKQPCQPPPQEPCIPKTKEPCQPKVPEPCHPKVPEPCQPKIPEPCQPKVPEPCPSTVTPAPAQQKTKQKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: SPRR1A small proline rich protein 1A [ Homo sapiens (human) ]
• Official Symbol: SPRR1A
• Synonyms: SPRR1A; small proline rich protein 1A; SPRK; cornifin-A; 19 kDa pancornulin; SPR-IA; small proline-rich protein IA
• Gene ID: 6698
• mRNA Refseq: NM_005987
• Protein Refseq: NP_005978
• MIM: 182265
• UniProt ID: P35321