Recombinant Human SPRR2F Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: SPRR2F-4569H
• Product Overview: SPRR2F MS Standard C13 and N15-labeled recombinant protein (NP_001014450) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: SPRR2F (Small Proline Rich Protein 2F) is a Protein Coding gene. Diseases associated with SPRR2F include Adenine Phosphoribosyltransferase Deficiency and Necrotizing Ulcerative Gingivitis. Among its related pathways are Keratinization and Developmental Biology.
• Molecular Mass: 7.6 kDa
• AA Sequence: MSYQQQQCKQPCQPPPVCPAPKCPEPCPPPKCPEPCPPSKCPQSCPPQQCQQKCPPVTPSPPCQPKCPPKSKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: SPRR2F small proline-rich protein 2F [ Homo sapiens (human) ]
• Official Symbol: SPRR2F
• Synonyms: SPRR2F; small proline-rich protein 2F; SPR-2F
• Gene ID: 6705
• mRNA Refseq: NM_001014450
• Protein Refseq: NP_001014450
• MIM: 617589
• UniProt ID: Q96RM1