Recombinant Human SPRR2F Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | SPRR2F-4569H |
Product Overview : | SPRR2F MS Standard C13 and N15-labeled recombinant protein (NP_001014450) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | SPRR2F (Small Proline Rich Protein 2F) is a Protein Coding gene. Diseases associated with SPRR2F include Adenine Phosphoribosyltransferase Deficiency and Necrotizing Ulcerative Gingivitis. Among its related pathways are Keratinization and Developmental Biology. |
Molecular Mass : | 7.6 kDa |
AA Sequence : | MSYQQQQCKQPCQPPPVCPAPKCPEPCPPPKCPEPCPPSKCPQSCPPQQCQQKCPPVTPSPPCQPKCPPKSKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | SPRR2F small proline-rich protein 2F [ Homo sapiens (human) ] |
Official Symbol | SPRR2F |
Synonyms | SPRR2F; small proline-rich protein 2F; SPR-2F; |
Gene ID | 6705 |
mRNA Refseq | NM_001014450 |
Protein Refseq | NP_001014450 |
MIM | 617589 |
UniProt ID | Q96RM1 |
◆ Recombinant Proteins | ||
SPRR2F-261H | Recombinant Human SPRR2F protein, GST-tagged | +Inquiry |
SPRR2F-4569H | Recombinant Human SPRR2F Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SPRR2F-2681H | Recombinant Human SPRR2F Protein, MYC/DDK-tagged | +Inquiry |
SPRR2F-15936M | Recombinant Mouse SPRR2F Protein | +Inquiry |
SPRR2F-8684M | Recombinant Mouse SPRR2F Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SPRR2F Products
Required fields are marked with *
My Review for All SPRR2F Products
Required fields are marked with *
0
Inquiry Basket