Recombinant Human SPRR4 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: SPRR4-2886H
• Product Overview: SPRR4 MS Standard C13 and N15-labeled recombinant protein (NP_775103) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: Cross-linked envelope protein of keratinocytes. Involved in UV-induced cornification.
• Molecular Mass: 8.8 kDa
• AA Sequence: MSSQQQQRQQQQCPPQRAQQQQVKQPCQPPPVKCQETCAPKTKDPCAPQVKKQCPPKGTIIPAQQKCPSAQQASKSKQKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: SPRR4 small proline rich protein 4 [ Homo sapiens (human) ]
• Official Symbol: SPRR4
• Synonyms: SPRR4; small proline rich protein 4; small proline-rich protein 4
• Gene ID: 163778
• mRNA Refseq: NM_173080
• Protein Refseq: NP_775103
• MIM: 616363
• UniProt ID: Q96PI1