Recombinant Human SPRR4 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | SPRR4-2886H |
Product Overview : | SPRR4 MS Standard C13 and N15-labeled recombinant protein (NP_775103) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Cross-linked envelope protein of keratinocytes. Involved in UV-induced cornification. |
Molecular Mass : | 8.8 kDa |
AA Sequence : | MSSQQQQRQQQQCPPQRAQQQQVKQPCQPPPVKCQETCAPKTKDPCAPQVKKQCPPKGTIIPAQQKCPSAQQASKSKQKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | SPRR4 small proline rich protein 4 [ Homo sapiens (human) ] |
Official Symbol | SPRR4 |
Synonyms | SPRR4; small proline rich protein 4; small proline-rich protein 4; |
Gene ID | 163778 |
mRNA Refseq | NM_173080 |
Protein Refseq | NP_775103 |
MIM | 616363 |
UniProt ID | Q96PI1 |
◆ Recombinant Proteins | ||
SPRR4-8688M | Recombinant Mouse SPRR4 Protein, His (Fc)-Avi-tagged | +Inquiry |
Sprr4-6108M | Recombinant Mouse Sprr4 Protein, Myc/DDK-tagged | +Inquiry |
SPRR4-2886H | Recombinant Human SPRR4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SPRR4-15941M | Recombinant Mouse SPRR4 Protein | +Inquiry |
SPRR4-2731H | Recombinant Human SPRR4 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SPRR4-1492HCL | Recombinant Human SPRR4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SPRR4 Products
Required fields are marked with *
My Review for All SPRR4 Products
Required fields are marked with *