Recombinant Human SPRYD3 Protein, GST-tagged

Cat.No. : SPRYD3-4248H
Product Overview : Human FLJ14800 partial ORF ( NP_116229, 1 a.a. - 100 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : SPRYD3 (SPRY Domain Containing 3) is a Protein Coding gene. An important paralog of this gene is RANBP9.
Molecular Mass : 36.74 kDa
AA Sequence : MRRTRRPRFVLMNKMDDLNLHYRFLNWRRRIREIREVRAFRYQERFKHILVDGDTLSYHGNSGEVGCYVASRPLTKDSNYFEVSIVDSGVRGTIAVGLVP
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name SPRYD3 SPRY domain containing 3 [ Homo sapiens ]
Official Symbol SPRYD3
Synonyms SPRYD3; SPRY domain containing 3; SPRY domain-containing protein 3; FLJ14800;
Gene ID 84926
mRNA Refseq NM_032840
Protein Refseq NP_116229
UniProt ID Q8NCJ5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SPRYD3 Products

Required fields are marked with *

My Review for All SPRYD3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon