Recombinant Human SPRYD3 Protein, GST-tagged
| Cat.No. : | SPRYD3-4248H |
| Product Overview : | Human FLJ14800 partial ORF ( NP_116229, 1 a.a. - 100 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | SPRYD3 (SPRY Domain Containing 3) is a Protein Coding gene. An important paralog of this gene is RANBP9. |
| Molecular Mass : | 36.74 kDa |
| AA Sequence : | MRRTRRPRFVLMNKMDDLNLHYRFLNWRRRIREIREVRAFRYQERFKHILVDGDTLSYHGNSGEVGCYVASRPLTKDSNYFEVSIVDSGVRGTIAVGLVP |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | SPRYD3 SPRY domain containing 3 [ Homo sapiens ] |
| Official Symbol | SPRYD3 |
| Synonyms | SPRYD3; SPRY domain containing 3; SPRY domain-containing protein 3; FLJ14800; |
| Gene ID | 84926 |
| mRNA Refseq | NM_032840 |
| Protein Refseq | NP_116229 |
| UniProt ID | Q8NCJ5 |
| ◆ Recombinant Proteins | ||
| SPRYD3-6033Z | Recombinant Zebrafish SPRYD3 | +Inquiry |
| Spryd3-6111M | Recombinant Mouse Spryd3 Protein, Myc/DDK-tagged | +Inquiry |
| SPRYD3-6208H | Recombinant Human SPRYD3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| SPRYD3-4248H | Recombinant Human SPRYD3 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SPRYD3-1489HCL | Recombinant Human SPRYD3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SPRYD3 Products
Required fields are marked with *
My Review for All SPRYD3 Products
Required fields are marked with *
