Recombinant Human SPTBN2, His-tagged
Cat.No. : | SPTBN2-30886TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 2149-2390 of Human SPTBN2 with an N terminal His tag; Predicted MWt 27 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 2149-2390 a.a. |
Description : | Spectrins are principle components of a cells membrane-cytoskeleton and are composed of two alpha and two beta spectrin subunits. The protein encoded by this gene (SPTBN2), is called spectrin beta non-erythrocytic 2 or beta-III spectrin. It is related to, but distinct from, the beta-II spectrin gene which is also known as spectrin beta non-erythrocytic 1 (SPTBN1). SPTBN2 regulates the glutamate signaling pathway by stabilizing the glutamate transporter EAAT4 at the surface of the plasma membrane. Mutations in this gene cause a form of spinocerebellar ataxia, SCA5, that is characterized by neurodegeneration, progressive locomotor incoordination, dysarthria, and uncoordinated eye movements. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 143 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | SQPLLGQQRLEHSSFPEGPGPGSGDEANGPRGERQTRTRG PAPSAMPQSRSTESAHAATLPPRGPEPSAQEQMEGMLC RKQEMEAFGKKAANRSWQNVYCVLRRGSLGFYKDAKAA SAGVPYHGEVPVSLARAQGSVAFDYRKRKHVFKLGLQD GKEYLFQAKDEAEMSSWLRVVNAAIATASSASGEPEEPVV PSTTRGMTRAMTMPPVSPVGAEGPVVLRSKDGRERERE KRFSFFKKNK |
Gene Name | SPTBN2 spectrin, beta, non-erythrocytic 2 [ Homo sapiens ] |
Official Symbol | SPTBN2 |
Synonyms | SPTBN2; spectrin, beta, non-erythrocytic 2; SCA5, spinocerebellar ataxia 5; spectrin beta chain, brain 2; |
Gene ID | 6712 |
mRNA Refseq | NM_006946 |
Protein Refseq | NP_008877 |
MIM | 604985 |
Uniprot ID | O15020 |
Chromosome Location | 11q13.2 |
Pathway | Axon guidance, organism-specific biosystem; Axon guidance, organism-specific biosystem; Developmental Biology, organism-specific biosystem; Developmental Biology, organism-specific biosystem; Interaction between L1 and Ankyrins, organism-specific biosystem; |
Function | actin binding; structural constituent of cytoskeleton; |
◆ Recombinant Proteins | ||
SPTBN2-30886TH | Recombinant Human SPTBN2, His-tagged | +Inquiry |
SPTBN2-5728R | Recombinant Rat SPTBN2 Protein | +Inquiry |
SPTBN2-5387R | Recombinant Rat SPTBN2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SPTBN2 Products
Required fields are marked with *
My Review for All SPTBN2 Products
Required fields are marked with *
0
Inquiry Basket