Recombinant Human SPTBN2, His-tagged

Cat.No. : SPTBN2-30886TH
Product Overview : Recombinant fragment, corresponding to amino acids 2149-2390 of Human SPTBN2 with an N terminal His tag; Predicted MWt 27 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 2149-2390 a.a.
Description : Spectrins are principle components of a cells membrane-cytoskeleton and are composed of two alpha and two beta spectrin subunits. The protein encoded by this gene (SPTBN2), is called spectrin beta non-erythrocytic 2 or beta-III spectrin. It is related to, but distinct from, the beta-II spectrin gene which is also known as spectrin beta non-erythrocytic 1 (SPTBN1). SPTBN2 regulates the glutamate signaling pathway by stabilizing the glutamate transporter EAAT4 at the surface of the plasma membrane. Mutations in this gene cause a form of spinocerebellar ataxia, SCA5, that is characterized by neurodegeneration, progressive locomotor incoordination, dysarthria, and uncoordinated eye movements.
Conjugation : HIS
Form : Lyophilised:Reconstitute with 143 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : SQPLLGQQRLEHSSFPEGPGPGSGDEANGPRGERQTRTRG PAPSAMPQSRSTESAHAATLPPRGPEPSAQEQMEGMLC RKQEMEAFGKKAANRSWQNVYCVLRRGSLGFYKDAKAA SAGVPYHGEVPVSLARAQGSVAFDYRKRKHVFKLGLQD GKEYLFQAKDEAEMSSWLRVVNAAIATASSASGEPEEPVV PSTTRGMTRAMTMPPVSPVGAEGPVVLRSKDGRERERE KRFSFFKKNK
Gene Name SPTBN2 spectrin, beta, non-erythrocytic 2 [ Homo sapiens ]
Official Symbol SPTBN2
Synonyms SPTBN2; spectrin, beta, non-erythrocytic 2; SCA5, spinocerebellar ataxia 5; spectrin beta chain, brain 2;
Gene ID 6712
mRNA Refseq NM_006946
Protein Refseq NP_008877
MIM 604985
Uniprot ID O15020
Chromosome Location 11q13.2
Pathway Axon guidance, organism-specific biosystem; Axon guidance, organism-specific biosystem; Developmental Biology, organism-specific biosystem; Developmental Biology, organism-specific biosystem; Interaction between L1 and Ankyrins, organism-specific biosystem;
Function actin binding; structural constituent of cytoskeleton;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SPTBN2 Products

Required fields are marked with *

My Review for All SPTBN2 Products

Required fields are marked with *

0
cart-icon