Recombinant Human SPTBN2, His-tagged

• Cat.No.: SPTBN2-30886TH
• Product Overview: Recombinant fragment, corresponding to amino acids 2149-2390 of Human SPTBN2 with an N terminal His tag; Predicted MWt 27 kDa.

Specification

• Description: Spectrins are principle components of a cells membrane-cytoskeleton and are composed of two alpha and two beta spectrin subunits. The protein encoded by this gene (SPTBN2), is called spectrin beta non-erythrocytic 2 or beta-III spectrin. It is related to, but distinct from, the beta-II spectrin gene which is also known as spectrin beta non-erythrocytic 1 (SPTBN1). SPTBN2 regulates the glutamate signaling pathway by stabilizing the glutamate transporter EAAT4 at the surface of the plasma membrane. Mutations in this gene cause a form of spinocerebellar ataxia, SCA5, that is characterized by neurodegeneration, progressive locomotor incoordination, dysarthria, and uncoordinated eye movements.
• Conjugation: HIS
• Source: E. coli
• Form: Lyophilised:Reconstitute with 143 μl aqua dest.
• Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: SQPLLGQQRLEHSSFPEGPGPGSGDEANGPRGERQTRTRG PAPSAMPQSRSTESAHAATLPPRGPEPSAQEQMEGMLC RKQEMEAFGKKAANRSWQNVYCVLRRGSLGFYKDAKAA SAGVPYHGEVPVSLARAQGSVAFDYRKRKHVFKLGLQD GKEYLFQAKDEAEMSSWLRVVNAAIATASSASGEPEEPVV PSTTRGMTRAMTMPPVSPVGAEGPVVLRSKDGRERERE KRFSFFKKNK

Gene Information

• Gene Name: SPTBN2 spectrin, beta, non-erythrocytic 2 [ Homo sapiens ]
• Official Symbol: SPTBN2
• Synonyms: SPTBN2; spectrin, beta, non-erythrocytic 2; SCA5, spinocerebellar ataxia 5; spectrin beta chain, brain 2
• Gene ID: 6712
• mRNA Refseq: NM_006946
• Protein Refseq: NP_008877
• MIM: 604985
• Uniprot ID: O15020
• Chromosome Location: 11q13.2
• Pathway: Axon guidance, organism-specific biosystem; Axon guidance, organism-specific biosystem; Developmental Biology, organism-specific biosystem; Developmental Biology, organism-specific biosystem; Interaction between L1 and Ankyrins, organism-specific biosystem
• Function: actin binding; structural constituent of cytoskeleton