Recombinant Human SQSTM1 protein(241-320 aa), C-His-tagged
Cat.No. : | SQSTM1-2854H |
Product Overview : | Recombinant Human SQSTM1 protein(Q13501)(241-320 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 241-320 aa |
Form : | 0.15 M Phosphate buffered saline |
Molecular Mass : | 11 kDa |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | GESVAAALSPLGIEVDIDVEHGGKRSRLTPVSPESSSTEEKSSSQPSSCCSDPSKPGGNVEGATQSLAEQMRKIALESEG |
Gene Name | SQSTM1 sequestosome 1 [ Homo sapiens ] |
Official Symbol | SQSTM1 |
Synonyms | SQSTM1; sequestosome 1; OSIL, oxidative stress induced like , Paget disease of bone 3 , PDB3; sequestosome-1; A170; p60; p62; p62B; EBIAP; EBI3-associated protein p60; oxidative stress induced like; ubiquitin-binding protein p62; EBI3-associated protein of 60 kDa; phosphotyrosine independent ligand for the Lck SH2 domain p62; phosphotyrosine-independent ligand for the Lck SH2 domain of 62 kDa; OSIL; PDB3; ZIP3; |
Gene ID | 8878 |
mRNA Refseq | NM_001142298 |
Protein Refseq | NP_001135770 |
MIM | 601530 |
UniProt ID | Q13501 |
◆ Recombinant Proteins | ||
SQSTM1-5391R | Recombinant Rat SQSTM1 Protein, His (Fc)-Avi-tagged | +Inquiry |
SQSTM1-30116H | Recombinant Human SQSTM1 protein, GST-tagged | +Inquiry |
Sqstm1-6120M | Recombinant Mouse Sqstm1 Protein, Myc/DDK-tagged | +Inquiry |
SQSTM1-3257H | Recombinant Human SQSTM1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SQSTM1-2093H | Recombinant Human SQSTM1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SQSTM1-1481HCL | Recombinant Human SQSTM1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SQSTM1 Products
Required fields are marked with *
My Review for All SQSTM1 Products
Required fields are marked with *