Recombinant Human SQSTM1 protein(241-320 aa), C-His-tagged
| Cat.No. : | SQSTM1-2854H |
| Product Overview : | Recombinant Human SQSTM1 protein(Q13501)(241-320 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 241-320 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Molecular Mass : | 11 kDa |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | GESVAAALSPLGIEVDIDVEHGGKRSRLTPVSPESSSTEEKSSSQPSSCCSDPSKPGGNVEGATQSLAEQMRKIALESEG |
| Gene Name | SQSTM1 sequestosome 1 [ Homo sapiens ] |
| Official Symbol | SQSTM1 |
| Synonyms | SQSTM1; sequestosome 1; OSIL, oxidative stress induced like , Paget disease of bone 3 , PDB3; sequestosome-1; A170; p60; p62; p62B; EBIAP; EBI3-associated protein p60; oxidative stress induced like; ubiquitin-binding protein p62; EBI3-associated protein of 60 kDa; phosphotyrosine independent ligand for the Lck SH2 domain p62; phosphotyrosine-independent ligand for the Lck SH2 domain of 62 kDa; OSIL; PDB3; ZIP3; |
| Gene ID | 8878 |
| mRNA Refseq | NM_001142298 |
| Protein Refseq | NP_001135770 |
| MIM | 601530 |
| UniProt ID | Q13501 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SQSTM1 Products
Required fields are marked with *
My Review for All SQSTM1 Products
Required fields are marked with *



