Recombinant Human SRD5A2 protein

Cat.No. : SRD5A2-81H
Product Overview : Recombinant Human SRD5A2 was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Description : This gene encodes a microsomal protein expressed at high levels in androgen-sensitive tissues such as the prostate. The encoded protein is active at acidic pH and is sensitive to the 4-azasteroid inhibitor finasteride. Deficiencies in this gene can result in male pseudohermaphroditism, specifically pseudovaginal perineoscrotal hypospadias (PPSH).
Form : 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Molecular Mass : 28 Kd
AA Sequence : MQVQCQQSPVLAGSATLVALGALALYVAKPSGYGKHTESLKPAATRLPARAAWFLQELPSFAVPAGILARQPLSL FGPPGTVLLGLFCLHYFHRTFVYSLLNRGRPYPAILILRGTAFCTGNGVLQGYYLIYCAEYPDGWYTDIRFSLGV FLFILGMGINIHSDYILRQLRKPGEISYRIPQGGLFTYVSGANFLGEIIEWIGYALATWSLPALAFAFFSLCFLG LRAFHHHRFYLKMFEDYPKSRKALIPFIF
Applications : Antibody Production; Functional Study: Recommended usage only, not validated yet. Compound Screening: Recommended usage only, not validated yet.
Notes : Heating may cause protein aggregation. Please do not heat this product before electrophoresis. Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name SRD5A2 steroid-5-alpha-reductase, alpha polypeptide 2 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 2) [ Homo sapiens ]
Official Symbol SRD5A2
Synonyms SRD5A2; steroid-5-alpha-reductase, alpha polypeptide 2 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 2); 3-oxo-5-alpha-steroid 4-dehydrogenase 2; S5AR 2; SR type 2; 5 alpha-SR2; type II 5-alpha reductase; steroid 5-alpha-reductase 2; 3-oxo-5 alpha-steroid 4-dehydrogenase 2; MGC138457;
Gene ID 6716
mRNA Refseq NM_000348
Protein Refseq NP_000339
MIM
UniProt ID P31213
Chromosome Location 2p23.1
Pathway Androgen biosynthesis, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of lipids and lipoproteins, organism-specific biosystem; Metabolism of steroid hormones and vitamins A and D, organism-specific biosystem; Prostate cancer, organism-specific biosystem; Prostate cancer, conserved biosystem; Steroid hormone biosynthesis, organism-specific biosystem;
Function 3-oxo-5-alpha-steroid 4-dehydrogenase activity; sterol 5-alpha reductase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SRD5A2 Products

Required fields are marked with *

My Review for All SRD5A2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon