Recombinant Human SREBF2 protein, GST-tagged
| Cat.No. : | SREBF2-1885H |
| Product Overview : | Recombinant Human SREBF2 protein(375-479 aa), fused with N-terminal GST tag, was expressed in E.coli. |
| Availability | January 11, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 375-479 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
| AASequence : | DYIKYLQQVNHKLRQENMVLKLANQKNKLLKGIDLGSLVDNEVDLKIEDFNQNVLLMSPPASDSGSQAGFSPYSIDSEPGSPLLDDAKVKDEPDSPPVALGMVDR |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | SREBF2 sterol regulatory element binding transcription factor 2 [ Homo sapiens ] |
| Official Symbol | SREBF2 |
| Synonyms | SREBF2; sterol regulatory element binding transcription factor 2; sterol regulatory element-binding protein 2; bHLHd2; SREBP2; SREBP-2; class D basic helix-loop-helix protein 2; sterol regulatory element-binding transcription factor 2; |
| Gene ID | 6721 |
| mRNA Refseq | NM_004599 |
| Protein Refseq | NP_004590 |
| MIM | 600481 |
| UniProt ID | Q12772 |
| ◆ Recombinant Proteins | ||
| SREBF2-7843H | Recombinant Human SREBF2 protein, His-tagged | +Inquiry |
| SREBF2-3652H | Recombinant Human SREBF2 protein, His-tagged | +Inquiry |
| SREBF2-5575Z | Recombinant Zebrafish SREBF2 | +Inquiry |
| SREBF2-8710M | Recombinant Mouse SREBF2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| RFL22242HF | Recombinant Full Length Human Sterol Regulatory Element-Binding Protein 2(Srebf2) Protein, His-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SREBF2 Products
Required fields are marked with *
My Review for All SREBF2 Products
Required fields are marked with *
