Recombinant Human SREK1IP1 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | SREK1IP1-2304H |
| Product Overview : | SFRS12IP1 MS Standard C13 and N15-labeled recombinant protein (NP_776190) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | Possible splicing regulator involved in the control of cellular survival. |
| Molecular Mass : | 18.2 kDa |
| AA Sequence : | MAVPGCNKDSVRAGCKKCGYPGHLTFECRNFLRVDPKRDIVLDVSSTSSEDSDEENEELNKLQALQEKRINEEEEKKKEKSKEKIKLKKKRKRSYSSSSTEEDTSKQKKQKYQKKEKKKEKKSKSKKGKHHKKEKKKRKKEKHSSTPNSSEFSRKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | SREK1IP1 SREK1-interacting protein 1 [ Homo sapiens (human) ] |
| Official Symbol | SREK1IP1 |
| Synonyms | SREK1IP1; SREK1-interacting protein 1; SFRS12 interacting protein 1, SFRS12IP1; protein SREK1IP1; FLJ36754; p18 splicing regulatory protein; P18SRP; protein SFRS12IP1; SFRS12-interacting protein 1; splicing regulatory protein of 18 kDa; SFRS12IP1; MGC131910; MGC150548; MGC150549; |
| Gene ID | 285672 |
| mRNA Refseq | NM_173829 |
| Protein Refseq | NP_776190 |
| UniProt ID | Q8N9Q2 |
| ◆ Recombinant Proteins | ||
| SREK1IP1-8712M | Recombinant Mouse SREK1IP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| SREK1IP1-4278R | Recombinant Rhesus Macaque SREK1IP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| SREK1IP1-15976M | Recombinant Mouse SREK1IP1 Protein | +Inquiry |
| SREK1IP1-5398R | Recombinant Rat SREK1IP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| SREK1IP1-2304H | Recombinant Human SREK1IP1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SREK1IP1-1907HCL | Recombinant Human SFRS12IP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SREK1IP1 Products
Required fields are marked with *
My Review for All SREK1IP1 Products
Required fields are marked with *
