Recombinant Human SREK1IP1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : SREK1IP1-2304H
Product Overview : SFRS12IP1 MS Standard C13 and N15-labeled recombinant protein (NP_776190) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Possible splicing regulator involved in the control of cellular survival.
Molecular Mass : 18.2 kDa
AA Sequence : MAVPGCNKDSVRAGCKKCGYPGHLTFECRNFLRVDPKRDIVLDVSSTSSEDSDEENEELNKLQALQEKRINEEEEKKKEKSKEKIKLKKKRKRSYSSSSTEEDTSKQKKQKYQKKEKKKEKKSKSKKGKHHKKEKKKRKKEKHSSTPNSSEFSRKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name SREK1IP1 SREK1-interacting protein 1 [ Homo sapiens (human) ]
Official Symbol SREK1IP1
Synonyms SREK1IP1; SREK1-interacting protein 1; SFRS12 interacting protein 1, SFRS12IP1; protein SREK1IP1; FLJ36754; p18 splicing regulatory protein; P18SRP; protein SFRS12IP1; SFRS12-interacting protein 1; splicing regulatory protein of 18 kDa; SFRS12IP1; MGC131910; MGC150548; MGC150549;
Gene ID 285672
mRNA Refseq NM_173829
Protein Refseq NP_776190
UniProt ID Q8N9Q2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SREK1IP1 Products

Required fields are marked with *

My Review for All SREK1IP1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon