Recombinant Human SRF

Cat.No. : SRF-30614TH
Product Overview : Recombinant fragment corresponding to amino acids 406-508 of Human Serum Response Factor SRF with an N terminal proprietary tag; Predicted MWt 36.96 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 103 amino acids
Description : This gene encodes a ubiquitous nuclear protein that stimulates both cell proliferation and differentiation. It is a member of the MADS (MCM1, Agamous, Deficiens, and SRF) box superfamily of transcription factors. This protein binds to the serum response element (SRE) in the promoter region of target genes. This protein regulates the activity of many immediate-early genes, for example c-fos, and thereby participates in cell cycle regulation, apoptosis, cell growth, and cell differentiation. This gene is the downstream target of many pathways; for example, the mitogen-activated protein kinase pathway (MAPK) that acts through the ternary complex factors (TCFs).
Molecular Weight : 36.960kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : HMMYPSPHAVMYAPTSGLGDGSLTVLNAFSQAPSTMQVSH SQVQEPGGVPQVFLTASSGTVQIPVSAVQLHQMAVIGQQA GSSSNLTELQVVNLDTAHSTKSE
Sequence Similarities : Contains 1 MADS-box domain.
Gene Name SRF serum response factor (c-fos serum response element-binding transcription factor) [ Homo sapiens ]
Official Symbol SRF
Synonyms SRF; serum response factor (c-fos serum response element-binding transcription factor); serum response factor; MCM1;
Gene ID 6722
mRNA Refseq NM_003131
Protein Refseq NP_003122
MIM 600589
Uniprot ID P11831
Chromosome Location 6p
Pathway Coregulation of Androgen receptor activity, organism-specific biosystem; ErbB1 downstream signaling, organism-specific biosystem; HTLV-I infection, organism-specific biosystem; HTLV-I infection, conserved biosystem; Heart Development, organism-specific biosystem;
Function RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription; contributes_to RNA polymerase II core promoter sequence-specific DNA binding transcription factor

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SRF Products

Required fields are marked with *

My Review for All SRF Products

Required fields are marked with *

0
cart-icon