Recombinant Human SRP54 protein(181-250 aa), C-His-tagged
| Cat.No. : | SRP54-2798H |
| Product Overview : | Recombinant Human SRP54 protein(P61011)(181-250 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 181-250 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | NENFEIIIVDTSGRHKQEDSLFEEMLQVANAIQPDNIVYVMDASIGQACEAQAKAFKDKVDVASVIVTKL |
| Gene Name | SRP54 signal recognition particle 54kDa [ Homo sapiens ] |
| Official Symbol | SRP54 |
| Synonyms | SRP54; signal recognition particle 54kDa; signal recognition particle 54kD; signal recognition particle 54 kDa protein; |
| Gene ID | 6729 |
| mRNA Refseq | NM_001146282 |
| Protein Refseq | NP_001139754 |
| MIM | 604857 |
| UniProt ID | P61011 |
| ◆ Recombinant Proteins | ||
| SRP54-11222Z | Recombinant Zebrafish SRP54 | +Inquiry |
| SRP54-5401R | Recombinant Rat SRP54 Protein, His (Fc)-Avi-tagged | +Inquiry |
| SRP54-5742R | Recombinant Rat SRP54 Protein | +Inquiry |
| SRP54-388HFL | Active Recombinant Full Length Human SRP54 Protein, C-Flag-tagged | +Inquiry |
| SRP54-4284R | Recombinant Rhesus Macaque SRP54 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SRP54-632HCL | Recombinant Human SRP54 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SRP54 Products
Required fields are marked with *
My Review for All SRP54 Products
Required fields are marked with *



