Recombinant Human SRPRB Protein, Flag-tagged

Cat.No. : SRPRB-2257H
Product Overview : Recombinant Human SRPRB Protein is produced by HEK293T expression system. This protein is fused with a Flag tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : Flag
Description : The protein encoded by this gene has similarity to mouse protein which is a subunit of the signal recognition particle receptor (SR). This subunit is a transmembrane GTPase belonging to the GTPase superfamily. It anchors alpha subunit, a peripheral membrane GTPase, to the ER membrane. SR is required for the cotranslational targeting of both secretory and membrane proteins to the ER membrane.
Form : PBS buffer
Molecular Mass : 30 kDa
AA Sequence : MASADSRRLADGGGAGGTFQPYLDTLRQELQQTDPTLLSVVVAVLAVLLTLVFWKLIRSRRSSQRAVLLVGLCDSGKTLLFVRLLTGLYRDTQTSITDSCAVYRVNNNRGNSLTLIDLPGHESLRLQFLERFKSSARAIVFVVDSAAFQREVKDVAEFLYQVLIDSMGLKNTPSFLIACNKQDIAMAKSAKLIQQQLEKELNTLRVTRSAAPSTLDSSSTAPAQLGKKGKEFEFSQLPLKVEFLECSAKGGRGDVGSADIQDLEKWLAKIASGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Gene Name SRPRB SRP receptor subunit beta [ Homo sapiens (human)]
Official Symbol SRPRB
Synonyms APMCF1; APMCF1
Gene ID 58477
mRNA Refseq NM_021203
Protein Refseq NP_067026
UniProt ID Q9Y5M8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SRPRB Products

Required fields are marked with *

My Review for All SRPRB Products

Required fields are marked with *

0
cart-icon