Recombinant Human SRPRB Protein, Flag-tagged
Cat.No. : | SRPRB-2257H |
Product Overview : | Recombinant Human SRPRB Protein is produced by HEK293T expression system. This protein is fused with a Flag tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | Flag |
Description : | The protein encoded by this gene has similarity to mouse protein which is a subunit of the signal recognition particle receptor (SR). This subunit is a transmembrane GTPase belonging to the GTPase superfamily. It anchors alpha subunit, a peripheral membrane GTPase, to the ER membrane. SR is required for the cotranslational targeting of both secretory and membrane proteins to the ER membrane. |
Form : | PBS buffer |
Molecular Mass : | 30 kDa |
AA Sequence : | MASADSRRLADGGGAGGTFQPYLDTLRQELQQTDPTLLSVVVAVLAVLLTLVFWKLIRSRRSSQRAVLLVGLCDSGKTLLFVRLLTGLYRDTQTSITDSCAVYRVNNNRGNSLTLIDLPGHESLRLQFLERFKSSARAIVFVVDSAAFQREVKDVAEFLYQVLIDSMGLKNTPSFLIACNKQDIAMAKSAKLIQQQLEKELNTLRVTRSAAPSTLDSSSTAPAQLGKKGKEFEFSQLPLKVEFLECSAKGGRGDVGSADIQDLEKWLAKIASGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Gene Name | SRPRB SRP receptor subunit beta [ Homo sapiens (human)] |
Official Symbol | SRPRB |
Synonyms | APMCF1; APMCF1 |
Gene ID | 58477 |
mRNA Refseq | NM_021203 |
Protein Refseq | NP_067026 |
UniProt ID | Q9Y5M8 |
◆ Recombinant Proteins | ||
SRPRB-8126H | Recombinant Human SRPRB protein, His & T7-tagged | +Inquiry |
SRPRB-3430H | Recombinant Human SRPRB protein, His-tagged | +Inquiry |
RFL32270HF | Recombinant Full Length Human Signal Recognition Particle Receptor Subunit Beta(Srprb) Protein, His-Tagged | +Inquiry |
SRPRB-5402R | Recombinant Rat SRPRB Protein, His (Fc)-Avi-tagged | +Inquiry |
SRPRB-691Z | Recombinant Zebrafish SRPRB | +Inquiry |
◆ Cell & Tissue Lysates | ||
SRPRB-1473HCL | Recombinant Human SRPRB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SRPRB Products
Required fields are marked with *
My Review for All SRPRB Products
Required fields are marked with *