Recombinant Human SRSF protein kinase 2 Protein, His tagged
| Cat.No. : | SRPK2-001H |
| Product Overview : | Recombinant Human SRSF protein kinase 2 protein (313-466 aa) with His tag was expressed in E. coli. |
| Availability | February 04, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 313-466 aa |
| Description : | Enables ATP binding activity; magnesium ion binding activity; and protein serine/threonine kinase activity. Involved in several processes, including R-loop processing; peptidyl-serine phosphorylation; and regulation of viral genome replication. Located in chromatin; cytosol; and nuclear lumen. |
| Molecular Mass : | 19 kDa |
| AA Sequence : | MNDQDGEYCPEVKLKTTGLEEAAEAETAKDNGEAEDQEEKEDAEKENIEKDEDDVDQELANIDPTWIESPKTNGHIENGPFSLEQQLDDEDDDEEDCPNPEEYNLDEPNAESDYTYSSSYEQFNGELPNGRHKIPESQFPEFSTSLFSGSLEPVAHHHHHHHH |
| Endotoxin : | < 1 EU/μg by LAL. |
| Purity : | > 90 % by SDS-PAGE |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Sterile PBS, pH7.4, 10 % Glycerol, 8 % Trehalose |
| Concentration : | 0.9 mg/mL by BCA |
| Gene Name | SRPK2 SRSF protein kinase 2 [ Homo sapiens (human) ] |
| Official Symbol | SRPK2 |
| Synonyms | SRPK2; SRSF protein kinase 2; SFRS protein kinase 2; serine/arginine rich splicing factor kinase 2; SFRSK2; SR protein kinase 2; H_RG152G17.1a; H_RG152G17.1b; WUGSC:H_RG152G17.1a; serine kinase SRPK2; SR-protein-specific kinase 2; serine/threonine-protein kinase SRPK2; serine/arginine-rich splicing factor kinase 2; serine/arginine-rich protein-specific kinase 2; FLJ36101 |
| Gene ID | 6733 |
| mRNA Refseq | NM_182691 |
| Protein Refseq | NP_872633 |
| MIM | 602980 |
| UniProt ID | P78362 |
| ◆ Recombinant Proteins | ||
| SRPK2-5207H | Recombinant Human SRPK2 protein, Avi-tagged, Biotinylated | +Inquiry |
| SRPK2-5206H | Recombinant Human SRPK2 protein | +Inquiry |
| SRPK2-2663H | Recombinant Human SRPK2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| SRPK2-4286R | Recombinant Rhesus Macaque SRPK2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| SRPK2-29989TH | Recombinant Human SRPK2 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SRPK2-1474HCL | Recombinant Human SRPK2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SRPK2 Products
Required fields are marked with *
My Review for All SRPK2 Products
Required fields are marked with *
