Recombinant Human SRSF protein kinase 2 Protein, His tagged

Cat.No. : SRPK2-001H
Product Overview : Recombinant Human SRSF protein kinase 2 protein (313-466 aa) with His tag was expressed in E. coli.
Availability July 31, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 313-466 aa
Description : Enables ATP binding activity; magnesium ion binding activity; and protein serine/threonine kinase activity. Involved in several processes, including R-loop processing; peptidyl-serine phosphorylation; and regulation of viral genome replication. Located in chromatin; cytosol; and nuclear lumen.
Molecular Mass : 19 kDa
AA Sequence : MNDQDGEYCPEVKLKTTGLEEAAEAETAKDNGEAEDQEEKEDAEKENIEKDEDDVDQELANIDPTWIESPKTNGHIENGPFSLEQQLDDEDDDEEDCPNPEEYNLDEPNAESDYTYSSSYEQFNGELPNGRHKIPESQFPEFSTSLFSGSLEPVAHHHHHHHH
Endotoxin : < 1 EU/μg by LAL.
Purity : > 90 % by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Storage Buffer : Sterile PBS, pH7.4, 10 % Glycerol, 8 % Trehalose
Concentration : 0.9 mg/mL by BCA
Gene Name SRPK2 SRSF protein kinase 2 [ Homo sapiens (human) ]
Official Symbol SRPK2
Synonyms SRPK2; SRSF protein kinase 2; SFRS protein kinase 2; serine/arginine rich splicing factor kinase 2; SFRSK2; SR protein kinase 2; H_RG152G17.1a; H_RG152G17.1b; WUGSC:H_RG152G17.1a; serine kinase SRPK2; SR-protein-specific kinase 2; serine/threonine-protein kinase SRPK2; serine/arginine-rich splicing factor kinase 2; serine/arginine-rich protein-specific kinase 2; FLJ36101
Gene ID 6733
mRNA Refseq NM_182691
Protein Refseq NP_872633
MIM 602980
UniProt ID P78362

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SRPK2 Products

Required fields are marked with *

My Review for All SRPK2 Products

Required fields are marked with *

0
cart-icon