Recombinant Human SRSF protein kinase 2 Protein, His tagged

• Cat.No.: SRPK2-001H
• Product Overview: Recombinant Human SRSF protein kinase 2 protein (313-466 aa) with His tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 313-466 aa
• Description: Enables ATP binding activity; magnesium ion binding activity; and protein serine/threonine kinase activity. Involved in several processes, including R-loop processing; peptidyl-serine phosphorylation; and regulation of viral genome replication. Located in chromatin; cytosol; and nuclear lumen.
• Molecular Mass: 19 kDa
• AA Sequence: MNDQDGEYCPEVKLKTTGLEEAAEAETAKDNGEAEDQEEKEDAEKENIEKDEDDVDQELANIDPTWIESPKTNGHIENGPFSLEQQLDDEDDDEEDCPNPEEYNLDEPNAESDYTYSSSYEQFNGELPNGRHKIPESQFPEFSTSLFSGSLEPVAHHHHHHHH
• Endotoxin: < 1 EU/μg by LAL.
• Purity: > 90 % by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Storage Buffer: Sterile PBS, pH7.4, 10 % Glycerol, 8 % Trehalose
• Concentration: 0.9 mg/mL by BCA

Gene Information

• Gene Name: SRPK2 SRSF protein kinase 2 [ Homo sapiens (human) ]
• Official Symbol: SRPK2
• Synonyms: SRPK2; SRSF protein kinase 2; SFRS protein kinase 2; serine/arginine rich splicing factor kinase 2; SFRSK2; SR protein kinase 2; H_RG152G17.1a; H_RG152G17.1b; WUGSC:H_RG152G17.1a; serine kinase SRPK2; SR-protein-specific kinase 2; serine/threonine-protein kinase SRPK2; serine/arginine-rich splicing factor kinase 2; serine/arginine-rich protein-specific kinase 2; FLJ36101
• Gene ID: 6733
• mRNA Refseq: NM_182691
• Protein Refseq: NP_872633
• MIM: 602980
• UniProt ID: P78362