Recombinant Human SRSF1 Protein (2-248 aa), His-SUMO-tagged
Cat.No. : | SRSF1-809H |
Product Overview : | Recombinant Human SRSF1 Protein (2-248 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Transcription. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 2-248 aa |
Description : | Plays a role in preventing exon skipping, ensuring the accuracy of splicing and regulating alternative splicing. Interacts with other spliceosomal components, via the RS domains, to form a bridge between the 5'- and 3'-splice site binding components, U1 snRNP and U2AF. Can stimulate binding of U1 snRNP to a 5'-splice site-containing pre-mRNA. Binds to purine-rich RNA sequences, either the octamer, 5'-RGAAGAAC-3' (r=A or G) or the decamers, AGGACAGAGC/AGGACGAAGC. Binds preferentially to the 5'-CGAGGCG-3' motif in vitro. Three copies of the octamer constitute a powerful splicing enhancer in vitro, the ASF/SF2 splicing enhancer (ASE) which can specifically activate ASE-dependent splicing. Isoform ASF-2 and isoform ASF-3 act as splicing repressors. May function as export adapter involved in mRNA nuclear export through the TAP/NXF1 pathway. |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 43.6 kDa |
AA Sequence : | SGGGVIRGPAGNNDCRIYVGNLPPDIRTKDIEDVFYKYGAIRDIDLKNRRGGPPFAFVEFEDPRDAEDAVYGRDGYDYDGYRLRVEFPRSGRGTGRGGGGGGGGGAPRGRYGPPSRRSENRVVVSGLPPSGSWQDLKDHMREAGDVCYADVYRDGTGVVEFVRKEDMTYAVRKLDNTKFRSHEGETAYIRVKVDGPRSPSYGRSRSRSRSRSRSRSRSNSRSRSYSPRRSRGSPRYSPRHSRSRSRT |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | SRSF1 serine/arginine-rich splicing factor 1 [ Homo sapiens ] |
Official Symbol | SRSF1 |
Synonyms | SRSF1; ASF; MGC5228; P33 subunit; SF2; SF2p33; SRp30a; ASF-1; SFRS1; FLJ53078; |
Gene ID | 6426 |
mRNA Refseq | NM_001078166 |
Protein Refseq | NP_001071634 |
MIM | 600812 |
UniProt ID | Q07955 |
◆ Recombinant Proteins | ||
SRSF1-02H | Recombinant Human SRSF1 Protein, N-GST and C-His-Tagged | +Inquiry |
SRSF1-1499H | Recombinant Human SRSF1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SRSF1-433HFL | Recombinant Full Length Human SRSF1 Protein, C-Flag-tagged | +Inquiry |
SRSF1-4289R | Recombinant Rhesus Macaque SRSF1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Srsf1-483M | Recombinant Mouse Srsf1 Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SRSF1-1910HCL | Recombinant Human SFRS1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SRSF1 Products
Required fields are marked with *
My Review for All SRSF1 Products
Required fields are marked with *
0
Inquiry Basket