Recombinant Human SRSF12 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | SRSF12-3343H |
| Product Overview : | SFRS13B MS Standard C13 and N15-labeled recombinant protein (NP_542781) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | Splicing factor that seems to antagonize SR proteins in pre-mRNA splicing regulation. |
| Molecular Mass : | 30.5 kDa |
| AA Sequence : | MSRYTRPPNTSLFIRNVADATRPEDLRREFGRYGPIVDVYIPLDFYTRRPRGFAYVQFEDVRGAEDALYNLNRKWVCGRQIEIQFAQGDRKTPGQMKSKERHPCSPSDHRRSRSPSQRRTRSRSSSWGRNRRRSDSLKESRHRRFSYSKSKSRSKSLPRRSTSARQSRTPRRNFGSRGRSRSKSLQKRSKSIGKSQSSSPQKQTSSGTKSRSHGRHSDSIARSPCKSPKGYTNSETKVQTAKHSHFRSHSRSRSYRHKNSWTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | SRSF12 serine/arginine-rich splicing factor 12 [ Homo sapiens (human) ] |
| Official Symbol | SRSF12 |
| Synonyms | SRSF12; serine/arginine-rich splicing factor 12; SFRS13B, splicing factor, arginine/serine rich 13B; SFRS19; splicing factor; arginine/serine rich 19; SR splicing factor 12; SRrp35; 35 kDa SR repressor protein; splicing factor, arginine/serine-rich 19; splicing factor, arginine/serine-rich 13B; serine-arginine repressor protein (35 kDa); SFRS13B; RP11-63L7.3; FLJ14459; FLJ33484; FLJ41221; |
| Gene ID | 135295 |
| mRNA Refseq | NM_080743 |
| Protein Refseq | NP_542781 |
| UniProt ID | Q8WXF0 |
| ◆ Recombinant Proteins | ||
| SRSF12-3343H | Recombinant Human SRSF12 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| Srsf12-6137M | Recombinant Mouse Srsf12 Protein, Myc/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SRSF12-1905HCL | Recombinant Human SFRS13B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SRSF12 Products
Required fields are marked with *
My Review for All SRSF12 Products
Required fields are marked with *
