Recombinant Human SRSF12 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: SRSF12-3343H
• Product Overview: SFRS13B MS Standard C13 and N15-labeled recombinant protein (NP_542781) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: Splicing factor that seems to antagonize SR proteins in pre-mRNA splicing regulation.
• Molecular Mass: 30.5 kDa
• AA Sequence: MSRYTRPPNTSLFIRNVADATRPEDLRREFGRYGPIVDVYIPLDFYTRRPRGFAYVQFEDVRGAEDALYNLNRKWVCGRQIEIQFAQGDRKTPGQMKSKERHPCSPSDHRRSRSPSQRRTRSRSSSWGRNRRRSDSLKESRHRRFSYSKSKSRSKSLPRRSTSARQSRTPRRNFGSRGRSRSKSLQKRSKSIGKSQSSSPQKQTSSGTKSRSHGRHSDSIARSPCKSPKGYTNSETKVQTAKHSHFRSHSRSRSYRHKNSWTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: SRSF12 serine/arginine-rich splicing factor 12 [ Homo sapiens (human) ]
• Official Symbol: SRSF12
• Synonyms: SRSF12; serine/arginine-rich splicing factor 12; SFRS13B, splicing factor, arginine/serine rich 13B; SFRS19; splicing factor; arginine/serine rich 19; SR splicing factor 12; SRrp35; 35 kDa SR repressor protein; splicing factor, arginine/serine-rich 19; splicing factor, arginine/serine-rich 13B; serine-arginine repressor protein (35 kDa); SFRS13B; RP11-63L7.3; FLJ14459; FLJ33484; FLJ41221
• Gene ID: 135295
• mRNA Refseq: NM_080743
• Protein Refseq: NP_542781
• UniProt ID: Q8WXF0