Recombinant Human SS18

Cat.No. : SS18-30032TH
Product Overview : Recombinant fragment of Human SS18 with N terminal proprietary tag. Predicted MW 36.74 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 101 amino acids
Description : Protein SSXT is a protein that in humans is encoded by the SS18 gene.
Molecular Weight : 36.740kDa inclusive of tags
Tissue specificity : Fairly ubiquitously expressed. Expressed in synovial sarcomas and in other human cell lines. The fusion genes SSXT-SSX1 and SSXT-SSX2 are expressed only in synovial sarcomas.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : APHMQNQMNGQMPGPNHMPMQGPGPNQLNMTNSSMNMPSSSHGSMGGYNHSVPSSQSMPVQNQMTMSQGQPMGNYGPRPNMSMQPNQGPMMHQQPPSQQYN
Sequence Similarities : Belongs to the SS18 family.
Gene Name SS18 synovial sarcoma translocation, chromosome 18 [ Homo sapiens ]
Official Symbol SS18
Synonyms SS18; synovial sarcoma translocation, chromosome 18; SSXT; protein SSXT; SYT;
Gene ID 6760
mRNA Refseq NM_005637
Protein Refseq NP_005628
MIM 600192
Uniprot ID Q15532
Chromosome Location 18q11.2
Pathway Transcriptional misregulation in cancers, organism-specific biosystem; Transcriptional misregulation in cancers, conserved biosystem;
Function ligand-dependent nuclear receptor transcription coactivator activity; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SS18 Products

Required fields are marked with *

My Review for All SS18 Products

Required fields are marked with *

0
cart-icon
0
compare icon