Recombinant Human SS18L2 protein, GST-tagged
Cat.No. : | SS18L2-2963H |
Product Overview : | Recombinant Human SS18L2 protein(1-77 aa), fused with N-terminal GST tag, was expressed in E.coli. |
Availability | October 11, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-77 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
AASequence : | MSVAFVPDWLRGKAEVNQETIQRLLEENDQLIRCIVEYQNKGRGNECVQYQHVLHRNLIYLATIADASPTSTSKAME |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | SS18L2 synovial sarcoma translocation gene on chromosome 18-like 2 [ Homo sapiens ] |
Official Symbol | SS18L2 |
Synonyms | SS18L2; synovial sarcoma translocation gene on chromosome 18-like 2; SS18-like protein 2; KIAA iso; SYT homolog 2; KIAA-iso; |
Gene ID | 51188 |
mRNA Refseq | NM_016305 |
Protein Refseq | NP_057389 |
MIM | 606473 |
UniProt ID | Q9UHA2 |
◆ Recombinant Proteins | ||
SS18L2-7428Z | Recombinant Zebrafish SS18L2 | +Inquiry |
Ss18l2-6138M | Recombinant Mouse Ss18l2 Protein, Myc/DDK-tagged | +Inquiry |
SS18L2-2963H | Recombinant Human SS18L2 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SS18L2-1467HCL | Recombinant Human SS18L2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SS18L2 Products
Required fields are marked with *
My Review for All SS18L2 Products
Required fields are marked with *