Recombinant Human SSBP3 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : SSBP3-1653H
Product Overview : SSBP3 MS Standard C13 and N15-labeled recombinant protein (NP_663768) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : SSBP3 (Single Stranded DNA Binding Protein 3) is a Protein Coding gene. Diseases associated with SSBP3 include Prostate Carcinoma In Situ and Panhypopituitarism, X-Linked. Gene Ontology (GO) annotations related to this gene include single-stranded DNA binding. An important paralog of this gene is SSBP2.
Molecular Mass : 40.4 kDa
AA Sequence : MFAKGKGSAVPSDGQAREKLALYVYEYLLHVGAQKSAQTFLSEIRWEKNITLGEPPGFLHSWWCVFWDLYCAAPERRDTCEHSSEAKAFHDYSAAAAPSPVLGNIPPNDGMPGGPIPPGFFQGPPGSQPSPHAQPPPHNPSSMMGPHSQPFMSPRYAGGPRPPIRMGNQPPGGVPGTQPLLPNSMDPTRQQGHPNMGGSMQRMNPPRGMGPMGPGPQNYGSGMRPPPNSLGPAMPGINMGPGAGRPWPNPNSANSIPYSSSSPGTYVGPPGGGGPPGTPIMPSPADSTNSSDNIYTMINPVPPGGSRSNFPMGPGSDGPMGGMGGMEPHHMNGSLGSGDIDGLPKNSPNNISGISNPPGTPRDDGELGGNFLHSFQNDNYSPSMTMSVTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name SSBP3 single stranded DNA binding protein 3 [ Homo sapiens (human) ]
Official Symbol SSBP3
Synonyms SSBP3; single stranded DNA binding protein 3; single-stranded DNA-binding protein 3; CSDP; FLJ10355; SSDP; SSDP1; sequence-specific single-stranded-DNA-binding protein;
Gene ID 23648
mRNA Refseq NM_145716
Protein Refseq NP_663768
MIM 607390
UniProt ID Q9BWW4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SSBP3 Products

Required fields are marked with *

My Review for All SSBP3 Products

Required fields are marked with *

0
cart-icon