Recombinant Human SSBP3 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | SSBP3-1653H |
Product Overview : | SSBP3 MS Standard C13 and N15-labeled recombinant protein (NP_663768) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | SSBP3 (Single Stranded DNA Binding Protein 3) is a Protein Coding gene. Diseases associated with SSBP3 include Prostate Carcinoma In Situ and Panhypopituitarism, X-Linked. Gene Ontology (GO) annotations related to this gene include single-stranded DNA binding. An important paralog of this gene is SSBP2. |
Molecular Mass : | 40.4 kDa |
AA Sequence : | MFAKGKGSAVPSDGQAREKLALYVYEYLLHVGAQKSAQTFLSEIRWEKNITLGEPPGFLHSWWCVFWDLYCAAPERRDTCEHSSEAKAFHDYSAAAAPSPVLGNIPPNDGMPGGPIPPGFFQGPPGSQPSPHAQPPPHNPSSMMGPHSQPFMSPRYAGGPRPPIRMGNQPPGGVPGTQPLLPNSMDPTRQQGHPNMGGSMQRMNPPRGMGPMGPGPQNYGSGMRPPPNSLGPAMPGINMGPGAGRPWPNPNSANSIPYSSSSPGTYVGPPGGGGPPGTPIMPSPADSTNSSDNIYTMINPVPPGGSRSNFPMGPGSDGPMGGMGGMEPHHMNGSLGSGDIDGLPKNSPNNISGISNPPGTPRDDGELGGNFLHSFQNDNYSPSMTMSVTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | SSBP3 single stranded DNA binding protein 3 [ Homo sapiens (human) ] |
Official Symbol | SSBP3 |
Synonyms | SSBP3; single stranded DNA binding protein 3; single-stranded DNA-binding protein 3; CSDP; FLJ10355; SSDP; SSDP1; sequence-specific single-stranded-DNA-binding protein; |
Gene ID | 23648 |
mRNA Refseq | NM_145716 |
Protein Refseq | NP_663768 |
MIM | 607390 |
UniProt ID | Q9BWW4 |
◆ Recombinant Proteins | ||
SSBP3-4484R | Recombinant Rhesus monkey SSBP3 Protein, His-tagged | +Inquiry |
SSBP3-6133C | Recombinant Chicken SSBP3 | +Inquiry |
SSBP3-5753R | Recombinant Rat SSBP3 Protein | +Inquiry |
SSBP3-1653H | Recombinant Human SSBP3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SSBP3-4300R | Recombinant Rhesus Macaque SSBP3 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SSBP3-1463HCL | Recombinant Human SSBP3 293 Cell Lysate | +Inquiry |
SSBP3-1462HCL | Recombinant Human SSBP3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SSBP3 Products
Required fields are marked with *
My Review for All SSBP3 Products
Required fields are marked with *
0
Inquiry Basket