Recombinant Human SSPN protein, GST-tagged
Cat.No. : | SSPN-301424H |
Product Overview : | Recombinant Human SSPN (1-73 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Met1-Leu73 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | MGKNKQPRGQQRQGGPPAADAAGPDDMEPKKGTGAPKECGEEEPRTCCGCRFPLLLALLQLALGIAVTVVGFL |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | SSPN sarcospan [ Homo sapiens ] |
Official Symbol | SSPN |
Synonyms | SSPN; sarcospan; KRAG, Kras oncogene associated gene; SPN1; SPN2; nanospan; microspan; Kras oncogene-associated; kirsten-ras-associated protein; K-ras oncogene-associated protein; sarcospan (Kras oncogene-associated gene); KRAG; NSPN; DAGA5; |
Gene ID | 8082 |
mRNA Refseq | NM_001135823 |
Protein Refseq | NP_001129295 |
MIM | 601599 |
UniProt ID | Q14714 |
◆ Recombinant Proteins | ||
SSPN-2858H | Recombinant Human SSPN Protein, MYC/DDK-tagged | +Inquiry |
RFL13337MF | Recombinant Full Length Mouse Sarcospan(Sspn) Protein, His-Tagged | +Inquiry |
SSPN-301424H | Recombinant Human SSPN protein, GST-tagged | +Inquiry |
SSPN-4304R | Recombinant Rhesus Macaque SSPN Protein, His (Fc)-Avi-tagged | +Inquiry |
SSPN-5704H | Recombinant Human SSPN Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
SSPN-1697HCL | Recombinant Human SSPN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SSPN Products
Required fields are marked with *
My Review for All SSPN Products
Required fields are marked with *
0
Inquiry Basket