Recombinant Human SSPN protein, GST-tagged

• Cat.No.: SSPN-301424H
• Product Overview: Recombinant Human SSPN protein(1-73 aa), fused with N-terminal GST tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-73 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients.
• AASequence: MGKNKQPRGQQRQGGPPAADAAGPDDMEPKKGTGAPKECGEEEPRTCCGCRFPLLLALLQLALGIAVTVVGFL
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.

Gene Information

• Gene Name: SSPN sarcospan [ Homo sapiens ]
• Official Symbol: SSPN
• Synonyms: SSPN; sarcospan; KRAG, Kras oncogene associated gene; SPN1; SPN2; nanospan; microspan; Kras oncogene-associated; kirsten-ras-associated protein; K-ras oncogene-associated protein; sarcospan (Kras oncogene-associated gene); KRAG; NSPN; DAGA5
• Gene ID: 8082
• mRNA Refseq: NM_001135823
• Protein Refseq: NP_001129295
• MIM: 601599
• UniProt ID: Q14714