Recombinant Human SSX1 protein, His-SUMO-tagged
| Cat.No. : | SSX1-755H |
| Product Overview : | Recombinant Human SSX1 protein(Q16384)(1-188aa), fused with N-terminal His and SUMO tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 1-188aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 34.9 kDa |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | MNGDDTFAKRPRDDAKASEKRSKAFDDIATYFSKKEWKKMKYSEKISYVYMKRNYKAMTKLGFKVTLPPFMCNKQATDFQGNDFDNDHNRRIQVEHPQMTFGRLHRIIPKIMPKKPAEDENDSKGVSEASGPQNDGKQLHPPGKANISEKINKRSGPKRGKHAWTHRLRERKQLVIYEEISDPEEDDE |
| Gene Name | SSX1 synovial sarcoma, X breakpoint 1 [ Homo sapiens ] |
| Official Symbol | SSX1 |
| Synonyms | SSX1; synovial sarcoma, X breakpoint 1; protein SSX1; cancer/testis antigen family 5; member 1; CT5.1; cancer/testis antigen 5.1; cancer/testis antigen family 5, member 1; sarcoma, synovial, X-chromosome-related 1; SSRC; MGC5162; MGC150425; |
| Gene ID | 6756 |
| mRNA Refseq | NM_005635 |
| Protein Refseq | NP_005626 |
| MIM | 312820 |
| UniProt ID | Q16384 |
| ◆ Recombinant Proteins | ||
| SSX1-2108H | Recombinant Human SSX1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| SSX1-755H | Recombinant Human SSX1 protein, His-SUMO-tagged | +Inquiry |
| SSX1-2040HFL | Recombinant Full Length Human SSX1 Protein, C-Flag-tagged | +Inquiry |
| SSX1-30141TH | Recombinant Human SSX1 | +Inquiry |
| SSX1-7541H | Recombinant Human SSX1, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SSX1-1450HCL | Recombinant Human SSX1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SSX1 Products
Required fields are marked with *
My Review for All SSX1 Products
Required fields are marked with *



