Recombinant Human SSX3 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : SSX3-3705H
Product Overview : SSX3 MS Standard C13 and N15-labeled recombinant protein (NP_066294) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The product of this gene belongs to the family of highly homologous synovial sarcoma X (SSX) breakpoint proteins. These proteins may function as transcriptional repressors. They are also capable of eliciting spontaneous humoral and cellular immune responses in cancer patients, and are potentially useful targets in cancer vaccine-based immunotherapy. While some of the related SSX genes are involved in t(X;18)(p11.2;q11.2) translocations that are characteristically found in all synovial sarcomas, this gene does not appear to be involved in such translocations.
Molecular Mass : 21.7 kDa
AA Sequence : MNGDDTFARRPTVGAQIPEKIQKAFDDIAKYFSKEEWEKMKVSEKIVYVYMKRKYEAMTKLGFKAILPSFMRNKRVTDFQGNDFDNDPNRGNQVQRPQMTFGRLQGIFPKIMPKKPAEEGNVSKEVPEASGPQNDGKQLCPPGKPTTSEKINMISGPKRGEHAWTHRLRERKQLVIYEEISDPEEDDETRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name SSX3 SSX family member 3 [ Homo sapiens (human) ]
Official Symbol SSX3
Synonyms SSX3; synovial sarcoma, X breakpoint 3; protein SSX3; CT5.3; cancer/testis antigen 5.3; synovial sarcoma, X breakpoint 3, isoform a; MGC14495; MGC119054;
Gene ID 10214
mRNA Refseq NM_021014
Protein Refseq NP_066294
MIM 300325
UniProt ID Q99909

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SSX3 Products

Required fields are marked with *

My Review for All SSX3 Products

Required fields are marked with *

0
cart-icon